Combination of a chemotherapeutic agent and an inhibitor of the TGF-beta system
专利摘要:
Pharmaceutical composition comprising a chemotherapeutic agent and a TGF-beta antisense oligonucleotide, wherein the antisense oligonucleotide reduces the sensitivity and IC, respectively, of the cytotoxicity of the chemotherapeutic agent. Preferably, the antisense oligonucleotide is a TGF-beta 1, 2, and/or 3 antisense oligonucleotide and the chemotherapeutic agent is preferably gemcitabine, 5-fluorouracil, temozolomide, dacarbacine, docetaxel, cisplatin, oxaliplatin, tamoxifen, or irinotecan. 公开号:AU2010277554A1 申请号:U2010277554 申请日:2010-07-30 公开日:2012-03-01 发明作者:Frank Jaschinski;Tanja Rothammer;Karl-Hermann Schlingensiepen;Anneliese Schneider 申请人:Antisense Pharma GmbH; IPC主号:C12N15-11
专利说明:
WO 2011/012713 PCT/EP2010/061152 Combination of a chemotherapeutic agent and an inhibitor of the TGF-beta system Field of the invention This invention refers to a pharmaceutical composition comprising a chemotherapeutic agent and an antisense oligonucleotide, preferably a TGF-beta antisense oligonucleotide, or any inhibitor of the TGF-beta system, wherein the antisense oligonucleotide or the inhibitor reduces the IC 50 of the chemotherapeutic agent's cytotoxicity, and thus, increases the efficiency of the chemotherapeutic agent. The invention is further directed to the use of the pharmaceutical composition for the preparation of a medicament for treating a neoplastic disease such as cancer, preferably pancreatic cancer, bladder cancer, glioma, astrocytoma, melanoma, renal carcinoma, lung cancer, breast cancer, ovary cancer, prostate cancer, colorectal cancer, gastric cancer, endometrial cancer, and osteosarcoma as well as to methods for production of such pharmaceutical composition. The use of a chemotherapeutic agent for the preparation of a medicament or radiation is the most common means, beside surgery, for the treatment of neoplastic diseases. Such a chemotherapeutic agent is for example an alkylating agent, an antimetabolite or an alkaloid derived from a plant. The effect of these chemotherapeutic agents and radiation is the unspecific inhibition of the cell proliferation and the unspecific induction of cell death, respectively, leading to numerous severe side effects. A chemotherapeutic agent or radiation inhibits for example proliferation of rapidly growing cells, other than tumor cells, such as hair follicle, colon mucosa cells or immune cells, e.g., T-lymphocytes, B-lymphocytes, natural killer cells, granulocytes, macrophages, microglia cells as well as the respective precursor cells of the bone marrow. In many cases the use of chemotherapeutic agents for the preparation of a medicament for treating cancer and/or the use of radiation do not lead to a sufficient result in the prolongation of the survival of a patient, in particular the median 1 WO 2011/012713 PCT/EP2010/061152 survival, which is sometimes enforced by the severe side effects of the chemotherapeutic agent and/or radiation. Muramaki et al., 2008, describe a chemosensitization of gemcitabine-resistant human bladder cancer cells by administration of a clusterin antisense oligonucleotide. It is known that the administration of gemcitabine upregulates the clusterin expression, i.e., the expression of sCLU-2 expression levels in a time dependent manner, which tends to result in resistance of the cell against gemcitabine. The sCLU-2 antisense oligonucleotide reduced the increased sCLU-2 expression level and chemosensitized the resistant cells to gemcitabine that the concentration of gemcitabine that reduces the effect by 50% (IC 50 ) is decresed from 100 nM to 10 nM. Combinations of chemotherapeutic agents and antisense oligonucleotides were further described by Alberts et al., 2004. Alberts et al. investigated the effect of gemcitabine and ISIS-2503, an H-ras phosphorothioate antisense oligonucleotide, on patients with locally advanced or metastatic pancreatic adenocarcinoma, wherein H-ras is a known oncogene. WO 2005/059133 A2 refers to pharmaceutical compositions comprising an antineoplastic chemotherapeutic agent and a stimulator of the immune system, which led to an increased cytocytoxicity of lymphokine activated killer cells (LAK cells) on glioma cells in comparison to a stimulator of the immune system alone. Paz-Ares et al., 2006, disclose the use of a combination of gemcitabine, cisplatin, and a protein kinase C-alpha antisense oligonucleotide for the preparation of a medicament for treating non-small-cell lung cancer. However, the use of the combination of these chemotherapeutic agents with the antisense oligonucleotide did not enhance the survival or show any other positive effect for the patient suffering from non-small-cell lung cancer. An alternative combination of gemcitabine and 5-fluorouracil for treating pancreatic carcinoma, which is described by Bellone et al., 2006, did likewise fail. 2 WO 2011/012713 PCT/EP2010/061152 WO 02/17852 A2 describes the combination of a bcl-2 antisense oligonucleotide with a chemoagent in specific administration doses, wherein the bcl-2 antisense oligonucleotide is administered to the patient at high doses for a short period of time, i.e., 14 days. Bcl-2 is an inhibitor of apoptosis since the chemotherapeutic agents described are inducers of apoptosis. Tumor cells become resistant to the chemotherapeutic agents by upregulating bcl-2. Hence, the objective problem underlying the present invention is improvement of efficiency of chemotherapeutic agents and pharmaceutical compositions comprising such chemotherapeutic agent, respectively, in the treatment of neoplastic diseases, in particular in non-resistant cells. Summary of the invention The present invention refers in one embodiment to a pharmaceutical composition comprising a chemotherapeutic agent and an inhibitor of the TGF-beta system, preferably an antisense oligonucleotide, e.g., an antitumoral antisense oligonucleotide, wherein the antisense oligonucleotide surprisingly leads to a reduction of the IC 50 of the cytotoxicity of the chemotherapeutic agent in a dose-dependent manner on the chemotherapeutic agent's cytotoxicity. A preferred antisense oligonucleotide is a TGF-beta antisense oligonucleotide like a TGF-beta 1, TGF-beta 2, or TGF-beta 3 antisense oligonucleotide, or combinations thereof, which hybridise with an area of the messenger RNA (m-RNA) and/or DNA encoding TGF-beta 1, -2 and/or -3, or hybridise with m-RNA and/or DNA encoding a TGF-beta 1, -2, and/or -3 receptor. Furthermore, the inhibitor of the TGF-beta system is for example selected from the group consisting of TGF-beta binding proteins that are no antibodies, TGF-beta binding receptors, parts of TGF-beta binding receptors, TGF-beta specific peptides and low molecular substances binding TGF-beta or any of their proteins, receptors, part of receptor protein or low molecular substance inhibiting the function of TGF-beta. 3 WO 2011/012713 PCT/EP2010/061152 The inhibitor of the TGF-beta system, e.g., the antisense oligonucleotide results in a reduction of the IC 5 0 of the chemotherapeutic agent's cytotoxicity in a resistant or a non resistant cell, i.e., a cell, which is resistant or non-resistant to the chemotherapeutic agent. The pharmaceutical composition of this invention is in particular for treating neoplastic diseases like cancer and for the treatment of autoimmune diseases. Preferably, the pharmaceutical composition is used for the preparation of a medicament for treating a neoplastic disease, preferably cancer. The pharmaceutical composition and/or its compounds are prepared in any dosage form and are administered in any route of administration known in the art. The pharmaceutical composition is suitable as a first line treatment of a neoplastic disease like cancer, or as a second, third etc. line treatment before, after or in combination with therapeutic treatments such as radiation. The chemotherapeutic agent and the inhibitor of the TGF-beta system of the pharmaceutical composition, preferably an antisense oligonucleotide are administered either separately or together in one formulation. If more than one chemotherapeutic agent and/or more than one inhibitor of the TGF-beta system, e.g., an antisense oligonucleotide is administered, the chemotherapeutic agent and/or inhibitors of the TGF-beta system such as an antisense oligonucleotide are administered separately or together in one formulation. In preferred embodiments, the administration of the inhibitor of the TGF-beta system such as an antisense oligonucleotide, follows or preceeds the administration of the chemotherapeutic agent, or the inhibitor of the TGF-beta system and the chemotherapeutic are administered concurrently. Due to the reduced IC 50 of the cytotoxicity of the chemotherapeutic agent, the effectivity of the chemotherapeutic agent is increased, and in a preferred embodiment the amount and dose, respectively, of the chemotherapeutic agent is reduced resulting advantageously in reduced severe negative side effects of the chemotherapeutic agent. 4 WO 2011/012713 PCT/EP2010/061152 In a further preferred embodiment the combination of the chemotherapeutic agent and the inhibitor of the TGF-beta system, for example the antisense oligonucleotide, in the present pharmaceutical composition leads to an advantageous extension of the patient's life time based on the supraadditive and synergistic, respectively, antitumoral effect of the compounds. Preferably, the chemotherapeutic agent does not negatively effect the interaction of the inhibitor of the TGF-beta system, e.g., an antisense oligonucleotide with its target. The present invention further relates to methods for the production of the pharmaceutical composition. Figures Figure 1 presents the reductive effect of a TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, on the IC 50 regarding gemcitabine's cytotoxicity in a dose dependent manner after data normalization. Gemcitabine was added to Hup-T3 cells, a pancreatic carcinoma cell line in concentrations of 5 tM, 2 tM, 800 nM, 320 nM, 128 nM, 51.2 nM, 20.5 nM, 8.2 nM, or 3.3 nM in combination with the TGF-beta 2 antisense oligonucleotide in concentrations of 0 tM (m), 5 tM (A), or 10 tM (7). 10 tM of the TGF beta 2 antisense oligonucleotide reduce the IC 50 of gemcitabine about 4 to 5 x in comparison to 0 tM TGF-beta 2 antisense oligonucleotide. Figure 2 shows the effect of gemcitabine on proliferation and viability, respectively, of Hup T3 cells and the secretion of TGF-beta 2 after data normalization. Gemcitabine at 5 tM, 500 nM, 50 nM, 5 nM, 0.5 nM, or 0.05 nM has no specific influence, in particular no specific inhibitory and/or stimulatory effect, on TGF-beta 2 secretion. The decrease of TGF-beta 2 secretion (m) correlates to the proliferation and viability, respectively, of the cells, which decreases at higher gemcitabine concentrations (A) due to the cytotoxic effect of gemcitabine. 5 WO 2011/012713 PCT/EP2010/061152 Figure 3 presents the dose dependent inhibitory effect of TGF-beta 2 antisense oligonucleotide on TGF-beta 2 secretion. TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, was administered to Hup-T3 cells in concentrations of 0 tM (control), 1 tM, 2.5 tM, 5 tM, 10 tM, 20 tM, 40 tM, 60 tM, or 80 tM. No gemcitabine was added to the cells. Figure 4 demonstrates that gemcitabine does not affect the interaction of the TGF-beta 2 antisense oligonucleotide with its target, and thus, does not affect the inhibitory effect of the antisense oligonucleotide on its target. The antisense oligonucleotide inhibited TGF-beta 2 secretion in a dose dependent manner (0 tM (m), 5 tM (A), or 10 tM (-) TGF-beta 2 antisense oligonucleotide) in the presence of gemcitabine (2 tM, 800 nM, 320 nM, 128 nM, 51.2 nM, 20.5 nM, 8.2 nM). At higher gemcitabine concentrations the proliferation and viability, respectively, of Hup-T3 cells decreased and gemcitabine indirectly influenced TGF beta 2 secretion via reducion of proliferation and viability, respectively, of the cells, which decreases at higher gemcitabine concentrations due to the cytotoxic effect of gemcitabine. Figure 5 shows the reductive effect of a TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, on the IC 50 regarding temozolomide's cytotoxicity in a dose dependent manner after data normalization. Temozolomide was added to MEL-Juso cells, a melanoma cell line, in concentrations of 200 tM, 100 tM, 50 tM, 25 tM, 12.5 tM, 6.25 tM, 3.125 tM, or 0 tM in combination with the TGF-beta 2 antisense oligonucleotide in concentrations of 0 tM (m), 5 tM (A), or 10 tM (V). 10 tM of the TGF-beta 2 antisense oligonucleotide reduced the IC 50 of temozolomide about 2 x in comparison to 0 tM TGF-beta 2 antisense oligonucleotide. Figure 6 demonstrates the effect of a TGF-beta 2 antisense oligonucleotide on the cytotoxicity of temozolomide. Temozolomide was administered to A-172 cells, a glioma cell line, in concentrations of 200 tM and 800 tM, respectively, either alone or in combination with 10 tM of a TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30. The combination of temozolomide with the TGF-beta 2 antisense oligonucleotide increased the 6 WO 2011/012713 PCT/EP2010/061152 cytotoxic effect of temozolomide significalty, about 2 to 3 x in comparison to temozolomide alone. Detailed description of the invention In the present invention, an inhibitor of the TGF-beta system such as an antisense oligonucleotide, in particular a TGF-beta 1 antisense oligonucleotide, TGF-beta 2 antisense oligonucleotide, and/or TGF-beta 3 antisense oligonucleotide, increases the efficiency of a chemotherapeutic agent in a cell, a tissue, and/or an organ of a subject. In a preferred embodiment, such antisense oligonucleotide is part of a pharmaceutical composition together with a chemotherapeutic agent, wherein the chemotherpeutic is for example gemcitabine, 5-fluorouracil, temozolomide, dacarbacine, docetaxel, cisplatin, oxaliplatin, tamoxifen, or irinotecan. The pharmaceutical composition of the present invention is applicable for treating a neoplastic disease in any mammal. Examples of mammal include laboratory animals, including rodents such as mice, rats and guinea pigs; farm animals such as cows, sheep, pigs and oats; pet animals such as dogs and cats; and primates such as monkeys, apes and humans. The pharmaceutical composition is most preferably applied in human clinical situations, particularly for treating neoplastic diseases. In one embodiment of this invention one or more chemotherapeutic agents and one or more antisense oligonucleotides and/or one or more inhibitors of the TGF-beta system inhibiting the cell proliferation, form a mixture comprising at least two of these components, wherein the components are either in a pure form or together with a pharmaceutically acceptable carrier, filler, lubricant, diluent, excipient, disintegrate, and/or adjuvant. In another embodiment of this invention, the one or more chemotherapeutic agents and the one or more inhibitors such as an antisense oligonucleotide, are separate in one pharmaceutical composition. The pharmaceutical composition comprises each of these components in a pure form or together with a pharmaceutically acceptable carrier, filler, 7 WO 2011/012713 PCT/EP2010/061152 lubricant, diluent, excipient, disintegrate, and/or adjuvant, wherein the pharmaceutically acceptable carrier, lubricant, diluent, excipient, disintegrate and/or adjuvant. The antisense oligonucleotide is preferably any TGF-beta antisense oligonucleotide, which reduces the ICs 0 of the cytotoxicity of the chemotherapeutic agent, and thus, increases the sensitivity of the cell, tissue, and/or organ to the chemotherapeutic agent in vitro, ex vivo, or in vivo. Such antisense oligonucleotides are for example directed against prostaglandine E2 (PGE, e.g., SEQ ID NO. 79-89), VEGF (e.g., SEQ ID NO. 90-126), or IL-10 (e.g., 127 146), and preferably against TGF-beta 1 (e.g., SEQ ID NO. 1-21), TGF-beta 2 (e.g., SEQ ID NO. 22-48), TGF-beta 3 (e.g., SEQ ID NO. 49-78). The antitumoral antisense oligonucleotide is an oligonucleotide affecting a tumor, wherein the antitumoral antisense oligonucleotide affects a tumor directly or indirectly. In a direct way, the antisense oligonucleotide blocks the transcription and expression, respectively, of a protein or peptide, which is for example a biological factor in the tumor, e.g., the production of TGF-beta, in particular of TGF beta 2. In an indirect way, the antisense oligonucleotide affects the transcription and/or expression of a protein or peptide, for example a factor inducing the function of an immune cell and/or the immune system and in consequence reducing or inhibiting the tumor cell growth and/or inducing cell death of a cancer cell. In an alternative embodiment, the inhibitor of the TGF-beta system such as an antisense oligonucleotide, in particluar the antitumoral antisense oligonucleotide, influences the signal transduction, i.e., leads to an increase or decrease of the signal transduction, of factors involved in tumor formation and/or persistance such as capillary formation in the tumor. Immune cells are for example lymphoid cells, such as T cells, B cells, NK cells (natural killer cells), NK T cells (natural killer T cells), granulocytes, such as neutrophils, eosinophils, basophils, and mononuclear cells such as monocytes, macrophages, dendritic cells and mast cells. In the context of this invention a TGF-beta inhibitor is any substance, e.g., a protein, 8 WO 2011/012713 PCT/EP2010/061152 peptide, small molelcule, inhibiting the function of TGF-beta in that any effect that is induced by TGF-beta is inhibited. In a preferred embodiment a TGF-beta inhibitor is a substance inhibiting the production of TGF-beta, a substance binding TGF-beta and/or a substance inhibiting the function of TGF beta downstream its activation cascade. For more details about TGF-beta antagonists see also Wojtowicz-Praga (2003). In particular, an inhibitor of the TGF-beta system is any substance able to inhibit the expression or function of TGF-beta, in particular TGF-beta 1, -2, and/or -3. The inhibitor is for example selected from the group consisting of TGF-beta binding proteins that are no antibodies, TGF-beta antibodies, TGF-beta binding receptors, parts of TGF-beta binding receptors, TGF-beta specific peptides and low molecular substances binding TGF-beta or any of their proteins, receptors, part of receptor protein or low molecular substance inhibiting the expression and/or the function of TGF-beta. Preferably, an inhibitor of the TGF-beta system has a molecular weight of less than about 10 kDa and more than about 1 Da of organic or inorganic origin inhibiting the TGF-beta system. In yet another embodiment the substance inhibiting the production of TGF-beta is a peptide, a peptide of less than 100 kDa, peptides being part of TGF-beta, a protein, a protein that is not an antibody, and/or a small molecule, e.g. tranilast (N-[3,4-dimethoxycinnamoyl] anthranilic acid) (Wilkenson, K.A. 2000). In one embodiment the peptides being part of TGF-beta are sequences of those given in example 9. Example 9 presents the amino acid sequences of TGF-beta 1, TGF-beta 2 and TGF-beta 3 also published in Mittl (1996). In one preferred embodiment peptides comprise the 112 amino acids counted from the end of the TGF-beta 1, TGF-beta 2 or TGF-beta 3 peptide as described in example 9. The start of those peptides is after the RXXR motif, ending 113 amino acids before the end of the TGF beta 1, TGF-beta 2 or TGF-beta 3 peptide, in which R is the amino acid Arginin and XX 9 WO 2011/012713 PCT/EP2010/061152 represents any amino acid or is even no amino acid. In one embodiment peptides being part of TGF-beta are parts of the sequences presented in example 9 comprising one to all amino acids of this peptide, in other embodiments preferred peptides comprise about 1-100 amino acids, about 2-50 amino acids, about 3-30 amino acids or about 5-20 amino acids of those peptides. In yet other embodiments preferred amino acids are those presented in example 7 for TGF beta 1, TGF-beta 2 and TGF-beta 3 with the respective numbers 1-78. Further preferred embodiments are parts of amino acids which are described above comprising or consisting of about 1-50 amino acids, about 1-40, about 2-30, about 3-25, about 4-18, about 5-15 or about 6-12 amino acids. In yet other embodiments of the peptides described above at least one of the basic amino acid selected from the group of Histidin (H), Lysin (K) and/or Arginin (R) is substituted by another basic amino acid selected from this group without loosing its TGF-beta antagonizing effects. In yet other embodiments of the peptides described above at least one of the acid amino acid selected from the group of glutaminic acid (E) and/or asparaginic acid (D) is substituted by its counterpart of this group without loosing its TGF-beta antagonizing effects. The peptides that are part of TGF-beta wherein some amino acids are replaced conservatively compared to their sequences presented in example 9 are also referred to as analogs of TGF-beta 1, TGf-beta 2 and/or TGF-beta 3. In some embodiments in the analogs of TGF beta 1, TGF-beta 2 and TGF-beta 3 about 1 % to about 30 %, about 2% to about 20%, about 3 % to about 15%, 4 % to about 12 % or about 5 % to about 10 % of the amino acids are replaced conservatively. 10 WO 2011/012713 PCT/EP2010/061152 Amino acid replaced conservatively, also referred to as conservative analogs or active derivatives of peptides in the context of this invention means replacing at least one amino acid of a peptide or protein. Preferably at least one acid amino acid (glutaminic acid (E), asparaginic acid (D)) is replaced by the respective other acid amino acid, accordingly at least one basic amino acid is replaced by another basic amino acid, at least one amino acid with a polar group (-OH, -SH, -CONH 2 ) is replaced by another amino acid with a polar group and/or amino acids with pure carbon side chains are replaced by another amino acid with pure carbone side chain. Peptides and/or proteins conservatively replaced with amino acids are still in the scope of this invention. In another embodiment the peptides described above are single and not in the combination with a chemotherapeutic agent. In yet another embodiment these peptides are used for preparing a pharmaceutical composition with a pharmaceutically acceptable carrier. In yet another embodiment these peptides are comprised by a pharmaceutical composition for the treatment of neoplastic diseases and in yet another embodiment these peptides are used for a method treating neoplastic diseases or used for the preparation of a medicament for treating a neoplastic disease according to this invention. The neoplastic disease is in particular a cancer or a tumor such as pancreatic cancer, bladder cancer, brain tumor, melanoma, renal carcinoma, lung cancer, breast cancer, ovary cancer, prostate cancer, colorectal cancer, gastric cancer, endometrial cancer, osteosarcoma, Myosarcoma, blood born tumors, leukemias, tumor metastasis, hemangiomas, acoustic neuromas, neurofibromas, trachomas, pyogenic, granulomas, psoriasis, astracytoma, acoustic neuroma, blastoma, Ewing's tumor, craniopharyngloma, ependymoma, medulloblastoma, glioma, hemangloblastoma, Hodgkins-lymphoma, medullablastoma, leukaemia, mesothelioma, neuroblastoma, neurofibroma, non-Hodgkins lymphoma, pinealoma, retinoblastoma, sarcoma, seminoma, trachomas, Wilm's tumor, bile duct carcinoma, bladder carcinoma, brain tumor, breast cancer, bronchogenic carcinoma, carcinoma of the kidney, cervical cancer, choriocarcinoma, cystadenocarcinome, embrional carcinoma, 11 WO 2011/012713 PCT/EP2010/061152 epithelial carcinoma, esophageal cancer, cervical carcinoma, colon carcinoma, colorectal carcinoma, endometrial cancer, gallbladder cancer, gastric cancer, head cancer, liver carcinoma, lung carcinoma, medullary carcinoma, neck cancer, non-small-cell bronchogenic/lung carcinoma, ovarian cancer, pancreas carcinoma, papillary carcinoma, papillary adenocarcinoma, prostata cancer, small intestine carcinoma, prostate carcinoma, rectal cancer, renal cell carcinoma, skin cancer, small-cell bronchogenic/lung carcinoma, squamous cell carcinoma, sebaceous gland carcinoma, testicular carcinoma, and uterine cancer. The brain tumor is in particular an oligodendroglioma, an anaplastic oligoastrozytoma, a glioblastoma, a brain metastasis, a myeloma, a plasmocytoma, a glioma, or an astrocytoma. In yet another embodiment TGF-beta inhibitors are receptors and/or parts of it, or an antibody and/or parts of it binding TGF-beta, or a protein and/or peptide binding to TGF beta and in that way inhibiting the function of TGF-beta. The antibodies are for example commercially available, see e.g. R & D Systems, Inc. The production of those antibodies is well known in the art. Animals such as e.g. chicken, mice, rabbits, goats, are immunized with purified human TGF-beta, and the animals produce an antibody against TGF-beta. The antibodies (e.g., IgY) are purified with e.g. affinity chromatography as described for example by Cooper, H.M. (1995) and are optionally further modified e.g., biotinylated. In a more preferred embodiment the TGF-beta antibodies are humanized antibodies as described for example by Carrington (1998). Preferred embodiments of the peptides are e.g. Latency assosciated peptides, which inhibit one or more or all three isoforms of TGF-beta (TGF-beta 1, TGF-beta 2 and TGF-beta 3). In another embodiment the TGF-beta inhibitor is a protein, peptide or a small molecule inhibiting the function of the TGF-beta receptor, acting extracellularly or intracellularly. Peptides and proteins are for example produced according to classical methods of peptide and protein synthesis such as Merrifield synthesis or Fmoc synthesis. In an alternative embodiment, an antisense oligonucleotide, preferably an antitumoral 12 WO 2011/012713 PCT/EP2010/061152 antisense oligonucleotide hybridizes with its target messenger RNA (mRNA) and/or DNA. The target mRNA and/or DNA is any mRNA and/or DNA that is directly or indirectly involved in the formation of a neoplastic disease such as cancer. In a preferred embodiment, the antisense oligonucleotide is a TGF-beta antisense oligonucleotide, for example a TGF-beta 1, TGF-beta 2, and/or TGF-beta 3, or its derivative, which hybridises with an area of the mRNA of TGF-beta and/or the DNA encoding TGF-beta, and thus, inhibit the production of TGF beta. The terms "nucleic acid" and "oligonucleotide" refer to multiple nucleotides (i.e. molecules comprising a sugar, e.g. ribose or deoxyribose) linked to a phosphate group and to a variable organic base, which is either a substituted pyrimidine, e.g. cytosine (C), thymine (T) or uracil (U) or a substituted purine, e.g. adenine (A) or guanine (G) or a modification thereof. As used herein, the terms refer to oligoribonucleotides as well as oligodeoxyribonucleotides. The terms shall also include oligonucleosides (i.e., a oligonucleotide without the phosphate) and any other organic base-containing polymer. The nucleic acids are double-stranded or single-stranded. Double-stranded molecules are more stable in vivo, while single-stranded molecules have increased activity. In one embodiment the nucleotides have lengths between about 6 and about 100 nucleotides in yet another embodiment the nucleotides have lengths of about 8 to about 40 nucleotides respectively from about 12 to about 32 nucleotides. As used herein with respect to linked units of a nucleic acid, "linked" or "linkage" means two entities are bound to one another by any physicochemical means. Any linkage known to those of ordinary skill in the art, covalent or noncovalent, is embraced. Natural linkages, which are those ordinarily found in nature connecting the individual units of a nucleic acid, are most common. The individual units of a nucleic acid are linked, however, by synthetic or modified linkages. In one embodiment the respective ends of this linear polymeric structure are further joined to form a circular structure. However, open linear structures are generally preferred. Within the oligonucleotides structure, the phosphate groups are commonly referred to as forming 13 WO 2011/012713 PCT/EP2010/061152 the internucleoside backbone of the oligonucleotide. The normal linkage or backbone of RNA and DNA is a 3'to 5'phosphodiester linkage. Antisense oligonucleotides or antitumoral antisense oligonucleotides include oligonucleotides having non-naturally occurring portions with similar function. Such modified or substituted oligonucleotides are often preferred over native forms because of desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for nucleic acid target (e.g. protein), altered intracellular localization and increased stability in the presence of nucleases. Modifications of the oligonucleotides as used herein comprise any chemical modifications of the sugar, the base moiety and/or the internucleoside linkage. In one embodiment oligonucleotides or antitumoral antisense oligonucleotides with a covalently modified base and/or sugar include for example oligonucleotides having backbone sugars which are covalently attached to low molecular weight organic groups other than a hydroxyl group at the 3' and/or 2' position and other than a phosphate group at the 5' position. Thus, modified oligonucleotides include for example a 2'-O-alkylated ribose group. In yet another embodiment modified oligonucleotides include sugars such as arabinose instead of ribose. Thus, the antisense oligonucleotide, in particular the antitumoral antisense oligonucleotide, is heterogeneous in the backbone composition comprising or containing any possible combination of polymer units linked together such as peptide-nucleic acids (which have amino acid backbone with nucleic acid bases). In some embodiments the oligonucleotides are homogeneous in the backbone composition. The substituted purines and pyrimidines of the oligonucleotides include standard purines and pyrimidines such as cytosine as well as base analogs such as substituted bases (Wagner et al. 1996). Purines and pyrimidines include, but are not limited to adenine, cytosine, guanine, thymine, 5-methylcytosine, 2-aminopurine, 2-amino-6-chloropurine, 2,6-diaminopurine, hypoxanthine, and other naturally and non-naturally occurring nucleobases, substituted and unsubstituted aromatic moieties. The single nucleotides in each oligonucleotide or polynucleotide polymer contain the same 14 WO 2011/012713 PCT/EP2010/061152 modifications, contain combinations of these modifications, or combine these modifications with phosphodiester linkages. Methods of rendering oligonucleotide or polynucleotide polymers nuclease resistant include, but are not limited to, covalently modifying the purine or pyrimidine bases. For example, bases are methylated, hydroxymethylated, or otherwise substituted (e.g., glycosylated) such that the oligonucleotides or polynucleotides are rendered substantially acid and nuclease resistant. In a preferred embodiment, at least one end-block on the oligonucleotide is a biotin, biotin analog, avidin, or avidin analog. These molecules have the ability to block the degradation of the protected oligonucleotide or polynucleotide and provide means for high affinity attachment of the modified oligonucleotides to the solid support. Avidin and biotin derivatives which are for example used to prepare the reagents of this invention include streptavidin, succinylated avidin, monomeric avidin, biocytin (biotin-epsilon-N-lysine), biocytin hydrazide, amine or sulfhydryl derivatives of 2-iminobiotin and biotinyl-epsilon aminocaproic acid hydrazide. Additional biotin derivatives, such as biotin-N hydroxysuccinimide ester, biotinyl-epsilon-aminocaproic acid-N-hydroxysuccinimide ester, sulfosuccinimidyl 6-(biotin amido)hexanoate, N-hydroxysuccinimideiminobiotin, biotinbromoacetylhydrazide, p-diazobenzoyl biocytin and 3-(N-maleimidopropionyl)biocytin, can also be used as end-blocking groups on the polynucleotides of the present invention. In another embodiment the ring structure of the ribose group of the nucleotides in the modified oligonucleotide has an oxygen in the ring structure substituted with N-H, N-R (with R being an alkyl or aryl substituent), S and/or methylene. In yet another embodiment the base units are maintained for hybridization with an appropriate nucleic acid target compound. One such oligomeric compound, an oligonucleotide mimetic that has been shown to have excellent hybridization properties, is for example a peptide nucleic acid (PNA). In PNA compounds, the sugar-backbone of an oligonucleotide is replaced with an amide containing backbone, in particular an aminoethylglycine backbone. The nucleobases are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. Representative United States patents 15 WO 2011/012713 PCT/EP2010/061152 that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos.: 5,539,082; 5,714,331; and 5,719,262. Further teaching of PNA compounds can be found in Nielsen et al. (1991). Further modified oligonucleotide backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphorotriesters, aminoalkylphosphorotriesters, methyl- and other alky-phosphonates including 3'-alkylene phophonates and chiral phosphonates, phosphinates, phosphoramidates, including 3 '-aminophosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having norm 3 '-5 'linkages, 2'-5'linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5'to 5'-3'or 2'-5'to 5'-2'. Various salts, mixed salts, and free acid forms are also included. In a further embodiment at least one nucleotide of an oligonucleotide is modified as described in one of the modifications above. The modifications cover either the oligonucleotide continuously or irregularly. In yet another embodiment at least two modifications as described above are combined within one oligonucleotide. In another embodiment the 1 to about 12 or 1 to about 8 or 1 to about 4 or 1 to about 2 oligonucleotides and/or nucleotide linkages at the 3' and/or 5 'end of the oligonucleotide are modified as described above. In one embodiment the antisense oligonucleotides of this invention are hybridizing with a target, e.g. TGF-beta or its subtypes TGF-beta 1, TGF-beta 2, TGF-beta 3, or VEGF, IL-10, or PGE. Antisense oligonucleotides of the sequence listing that comprise additional nucleotides for example about 1 to about 1000 nucleotides, from about 1 to about 500, from about 1 to 16 WO 2011/012713 PCT/EP2010/061152 about 100, from about 1 to about 50, from about 1 to about 20, from about 1 to about 10, from about 1 to about 5 or from about 1 to about 2 nucleotides bound to at least one of the 3' and/or 5' end, in a preferred embodiment on at least one of the 2' and/or 5 'end, are still within the scope of this invention. The antisense oligonucleotides are synthesized de novo using any of a number of procedures well known in the art resulting in "synthetic antisense oligonucleotides". Such procedures are for example, the b-cyanoethyl phosphoramidite method (Beaucage et al. 1981), or the nucleoside H-phosphonate method (Garegg et al. 1986, Froehler et al. 1986, Garegg et al. 1986, Gaffney et al. 1988). These antisense oligonucleotides are performed by a variety of automated oligonucleotide synthesizers available on the market. Alternatively, antisense oligonucleotides are produced in a large scale in plasmids, (see, e.g., Sambrook, et al. 1989) and separated into smaller pieces or administered as a whole. Antisense oligonucleotides are prepared from existing nucleic acid sequences (e.g., genomic or cDNA) using known techniques, such as those employing restriction enzymes, exonucleases or endonucleases. Antisense oligonucleotides prepared in this manner are referred to as isolated nucleic acids. Antisense oligonucleotides and antitumoral antisense oligonucleotide, respectively, encompasse both synthetic and isolated antisense oligonucleotides. Antisense oligonucleotides having a modified backbone, e.g., phosphorothioate bonds, are synthesized using automated techniques employing, for example, phosphoramidate or H phosphonate chemistries. Aryl- and alkyl-phosphonates are made, e.g., as described in U.S. Pat. No. 4,469,863. Alkyiphosphotriesters, in which the charged oxygen moiety is alkylated as described in U.S. Pat. No. 5,023,243 and European Patent No. 092,574, are prepared by automated solid phase synthesis using commercially available reagents. Methods for producing further backbone modifications of the antisense oligonucleotide and substitutions have been described (Uhlmann et al. 1990, Goodchild 1990). 17 WO 2011/012713 PCT/EP2010/061152 Alternatively, phosphorothioates are synthesized using automated techniques employing either phosphoramidate or H-phosphonate chemistries. Aryl- and alkyl-phosphonates are made, e.g., as described in U.S. Pat. No. 4,469,863; and alkylphosphotriesters (in which the charged oxygen moiety is alkylated as described in U.S. Pat. No. 5,023,243 and European Patent No. 092,574) are prepared by automated solid phase synthesis using commercially available reagents. Methods for making other DNA backbone modifications and substitutions have been described (Uhlmann, E. et al. 1990, Goodchild, J. 1990). The term "neoplastic disease" according to the present invention refers to a proliferative disorder caused or characterized by the proliferation of cells, which have lost susceptibility to normal growth control. The term "cancer" according to the present invention includes benigne and maligne tumors and any other proliferative disorders for example the formation of metastasis. Cancers of the same tissue type in general originate from the same tissue, and are for example divided into different subtypes based on their biological characteristics. Four general categories of cancers are carcinoma, sarcoma, leukemia, and lymphoma. Over 200 different types of cancers are known, and every organ or tissue of the body can be affected. Specific examples of cancers that do not limit the definition of cancer includes solid tumors, blood born tumors such as leukemias, acute or chronic myelotic or lymphoblastic leukemia; tumor metastasis; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; pre-malignant tumors; astrocytoma, comprising pilocyt. astrocytoma WHO I, astrocytoma WHO II, astrocytoma WHO III, blastoma, breast cancer, chordoma, craniopharyngioma, endometrial cancer, ependymoma, Ewing 's tumor, gastric cancer, germinoma, glioma, glioblastoma, hemangioblastoma, hemangioperycatioma, Hodgkins lymphoma, medulloblastoma, leukaemia, mesothelioma, neuroblastoma, non-Hodgkins lymphoma, pinealoma, retinoblastoma, sarcoma (including angiosarcoma, chondrosarcoma, endothelial sarcoma, fibrosarcoma, leiomyosarcoma, liposarcoma, lymphangioandotheliosarcoma, lyphangiosarcoma, medulloblastoma, melanoma, meningioma, myosarcoma, neurinoma, oligodendroglioma, osteogenic sarcoma, osteosarcoma), seminoma, subependymoma, Wilm's tumor, or is selected from the group of bile duct carcinoma, bladder carcinoma, brain tumor, breast carcinoma, bronchogenic carcinoma, carcinoma of the kidney, cervical carcinoma, choriocarcinoma, 18 WO 2011/012713 PCT/EP2010/061152 cystadenocarcinome, embryonal carcinoma, epithelial carcinoma, esophageal carcinoma, cervical carcinoma, colon carcinoma, colorectal carcinoma, endometrial carcinoma, gallbladder carcinoma, gastric carcinoma, head and neck carcinoma, liver carcinoma, lung carcinoma, medullary carcinoma, non-small cell bronchogenic/lung carcinoma, lung cancer, ovarian carcinoma, pancreas carcinoma, papillary carcinoma, papillary adenocarcinoma, prostate carcinoma, small intestine carcinoma, rectal carcinoma, renal cell carcinoma, skin carcinoma, small-cell bronchogenic/lung carcinoma, squamous cell carcinoma, sebaceous gland carcinoma, testicular carcinoma, osteosarcoma, ovary cancer, or uterine carcinoma. In a preferred embodiment the formation of metastasis refers to the formation of liver, lung, brain, lymphoma node and/or visceral metastasis. Each of these metastasis is treatable by use of the pharmaceutical composition of the presentinvention. A chemotherapeutic agent according to the present invention is a substance inhibiting cell proliferation and/or inducing cell death and in a preferred embodiment further inhibits the formation of metastases. The term chemotherapeutic agent comprises, but is not limited to a chemotherapeutic agent, chemotherapeutic agent supplementary potentiating agents and radioactive agents. Examples for this group are given herein. In one embodiment a chemotherapeutic agent is selected from the group of gemcitabine, telozolomid, nitrosoureas, Vinca alkaloids, antagonists of purine and pyrimidines bases, cytostatic antibiotics, camphotecine derivatives, anti-estrogenes, anti-androgens and analogs of gonadotropin releasing hormon. In a preferred embodiment the group of nitrosoureas comprises ACNU, BCNU, CCNU, and/or HCNU. In another embodiment the antineoplastic chemotherapeutic agent agent is selected from the group of nitrosoureas, e.g. ACNU, BCNU, HCNU and/or CCNU, cytotoxic active antibiotics, e.g. doxorubicin, pegylated liposomal doxorubicin (Caelyx®), 5 fluorodeoxyuridine, 5-fluorouracil, 5-fluorouridine, gemcitabine, procarbazine, taxol, taxotere, temozolomide, vinblastine, vincristine. Synonyms for ACNU are 3-[(-4-Amino-2 methyl-5-pyrimidinyl)methyl]-1-(2-chloroethyl)-1-nitrosourea hydrochloride, CS-439 HCI, 19 WO 2011/012713 PCT/EP2010/061152 Nidran hydrochloride, Nimustine Hydrochloride, NSC-245382. BCNU is Bischloroethylnitrosourea, the chemical name is N,N '-bis(2-chlorethyl)-N-nitroso-urea, other names are BiCNU, carmustine. CCNU is 1-(2-Chloroethy)-3-cyclohexyl-1-nitrosourea. Synonyms are N-(2-chloroethyl)-N '-cyclohexyl-N-nitroso-urea, Belustine, Cee NU, Chloroethylcyclohexylnitrosourea, ICIG 1109, Lomustine, NSC 79037. One chemical name for temozolomide is 3,4-dihydro-3-methyl-4-oxoimidazo->5,ld'1,2,3,4-tetrazin-8 carboximide. Other names for temozolomide are Temodal, Temodar, methazolastone, CCRG81045, SCH52365, NSC362856, M&B39836. Synonyms for teniposide are 4'-Demethylepipodophyllotoxin, 9-(4,6-0-2-thenylidene-b-D glucopyranoside), Epipodophyllotoxin, EPT, Teniposide VM-26, VM 26, 5,8,8a,9-Tetrahydro 5-(4-hydroxy-3,5-dimethoxyphenyl)-9-{[4,6-0-(2-thienylmethylene)-b-D glucopyranosyl]oxy}furo[3',4':6,7]naphtho[2,3-d]-1,3-dioxol-6(5aH)-one. In one embodiment the Vinca alkaloids comprise vincristine, vinblastine, vindesine and their active derivatives. In one embodiment the antagonist of the purine and pyrimidine bases is selected from the group of 5-fluorouracile, 5-fluorodeoxiuridine, cytarabine and gemcitabine. In other embodiments the chemotherapeutic agent is selected from the group of doxorubicine and liposomal PEGylated doxorubicin, the camphthotecine derivative is selected from the group of irinotecane and topotecane, the anti estrogenes are selected from the group of tamoxifen, exemestane, anastrozole and fulvestrant, the antiandrogens are selected from the group of flutamide and bicalutamide, the antprogesterons are selected from the group of mifepriston, the analogs of gonadotropin releasing hormon are selected from the group of leuprolide and gosereline. In other embodiments the at least one antisense oligonucleotide, preferably an antisense oligonucleotide selected from the group consisting of TGF-beta 1, TGF-beta 2, and TGF-beta 3, and/or inhibitor if the TGF-beta inhibitor is combined with at least one chemotherapeutic 20 WO 2011/012713 PCT/EP2010/061152 selected from the following group: Acivicin; Aclarubicin; Acodazole Hydrochloride; Acronine; Adozelesin; Adriamycin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Avastin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carboplatin; Carmustine; Carubicin Hydrochloride; Carzelesin; Cedefingol; Cetuximab; Chlorambucil; Cirolemycin; Cisplatin; Cladribine; Crisnatol Mesylate; Cyclophosphamide; Cytarabine; Dacarbazine; DACA (N-[2-(Dimethyl-amino)ethyl]acridine-4-carboxamide); Dactinomycin; Daunorubicin Hydrochloride; Daunomycin; Decitabine; Dexormaplatin; Dezaguanine; Dezaguanine Mesylate; Diaziquone; Docetaxel; Doxorubicin; Doxorubicin Hydrochloride; Droloxifene; Droloxifene Citrate; Dromostanolone Propionate; Duazomycin; Edatrexate; Eflornithine Hydrochloride; Elsamitrucin; Enloplatin; Enpromate; Epipropidine; Epirubicin Hydrochloride; Erbulozole; Erlotinib; Esorubicin Hydrochloride; Estramustine; Estramustine Phosphate Sodium; Etanidazole; Ethiodized Oil I 131; Etoposide; Etoposide Phosphate; Etoprine; Fadrozole Hydrochloride; Fazarabine; Fenretinide; Floxuridine; Fludarabine Phosphate; 5-Fluorouracil; 5-FdUMP; Flurocitabine; Fosquidone; Fostriecin Sodium; Gefitinib; Gemcitabine; Gemcitabine Hydrochloride; Gold Au 198 ; Hydroxyurea; Idarubicin Hydrochloride; Ifosfamide; Ilmofosine; Imatinib mesylate; Interferon Alfa-2a; Interferon Alfa-2b ; Interferon Alfa-n1; Interferon Alfa-n3; Interferon Beta-I a; Interferon Gamma-I b; Iproplatin; Iressa; Irinotecan Hydrochloride; Lanreotide Acetate; Letrozole; Leuprolide Acetate; Liarozole Hydrochloride; Lometrexol Sodium; Lomustine; Losoxantrone Hydrochloride; Masoprocol; Maytansine; Mechlorethamine Hydrochloride; Megestrol Acetate; Melengestrol Acetate; Melphalan; Menogaril; Mercaptopurine; Methotrexate; Methotrexate Sodium; Metoprine; Meturedepa; Mitindomide; Mitocarcin; Mitocromin; Mitogillin; Mitomalcin; Mitomycin; Mitosper; Mitotane; Mitoxantrone Hydrochloride; Mycophenolic Acid; Nocodazole; Nogalamycin; Ormaplatin; Oxaliplatin; Oxisuran; Paclitaxel; Pegaspargase; Peliomycin; Pentamustine; Peplomycin Sulfate; Perfosfamide; Pipobroman; Piposulfan; Piroxantrone Hydrochloride; Plicamycin; Plomestane; Porfimer Sodium; Porfiromycin; Prednimustine; Procarbazine Hydrochloride; Puromycin; Puromycin Hydrochloride; Pyrazofurin; Riboprine; Rituximab; Rogletimide; Safinol; Safingol Hydrochloride; Semustine; 21 WO 2011/012713 PCT/EP2010/061152 Simtrazene; Sparfosate Sodium; Sparsomycin; Spirogermanium Hydrochloride; Spiromustine; Spiroplatin; Streptonigrin; Streptozocin; Strontium Chloride Sr 89; Sulofenur; Talisomycin; Tamoxifen; Taxane; Taxoid; Tecogalan Sodium; Tegafur; Teloxantrone Hydrochloride; Temoporfin; Teniposide; Teroxirone; Testolactone; Thiamiprine; Thioguanine; Thiotepa; Thymitaq; Tiazofurin; Tirapazamine; Tomudex; TOP-53; Topotecan Hydrochloride; Toremifene Citrate; Trastuzumab; Trestolone Acetate; Triciribine Phosphate; Trimetrexate; Trimetrexate Glucuronate; Triptorelin; Tubulozole Hydrochloride; Uracil Mustard; Uredepa; Vapreotide; Verteporfin; Vinblastine; Vinblastine Sulfate; Vincristine; Vincristine Sulfate; Vindesine; Vindesine Sulfate; Vinepidine Sulfate; Vinglycinate Sulfate; Vinleurosine Sulfate; Vinorelbine Tartrate; Vinrosidine Sulfate; Vinzolidine Sulfate; Vorozole; Zeniplatin; Zinostatin; Zorubicin Hydrochloride; 2-Chlorodeoxyadenosine; 2'-Deoxformycin; 9-aminocamptothecin; raltitrexed; N-propargyl-5,8-dideazafolic acid; 2-chloro-2'-arabino fluoro-2'-deoxyade- nosine; 2-chloro-2'-deoxyadenosine; anisomycin; trichostatin A; hPRL G129R; CEP-751; linomide. Other chemotherapeutic agents include: 20-epi-1,25 dihydroxyvitamin D3; 5-ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; amsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsalizing morphogenetic protein-1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin; azatyrosine; baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists; benzochlorins; benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine; calcipotriol; calphostin C; camptothecin derivatives (e.g., 10-hydroxy-camptothecin); canarypox IL-2; capecitabine; carboxamide amino-triazole; carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; 22 WO 2011/012713 PCT/EP2010/061152 chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4; combretastatin analogue; conagenin; crambescidin 816; crisnatol; cryptophycin 8; cryptophycin A derivatives; curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexifosfamide; dexrazoxane; dexverapamil; diaziquone; didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; dihydrotaxol, 9-; dioxamycin; diphenyl spiromustine; discodermolide; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur; epirubicin; epothilones including desoxyepothilones (A, R.dbd.H; B, R.dbd.Me); epithilones; epristeride; estramustine analogue; estrogen agonists; estrogen antagonists; etanidazole; etoposide; etoposide 4'-phosphate (etopofos); exemestane; fadrozole; fazarabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin hydrochloride; forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin; gallium nitrate; galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod; immunostimulant peptides; insulin-like growth factor-1 receptor inhibitor; interferon agonists; interferons;interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; irinotecan; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; leinamycin; lenograstim; lentinan sulfate; leptolstatin; letrozole; leukemia inhibiting factor; leukocyte alpha interferon; leuprolide+estrogen+progesterone; leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol; lonidamine; losoxantrone; lovastatin; loxoribine; lurtotecan; lutetium texaphyrin; lysofylline; lytic peptides; maitansine; mannostatin A; marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MIF inhibitor; mifepristone; miltefosine; mirimostim; mismatched double stranded RNA; mithracin; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; 23 WO 2011/012713 PCT/EP2010/061152 mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1-based therapy; mustard anticarcinoma agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N-acetyldinaline; N substituted benzamides; nafarelin; nagrestip; naloxone+pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid; neutral endopeptidase; nilutamide; nisamycin; nitric oxide modulators; nitroxide antioxidant; nitrullyn; 06-benzylguanine; octreotide; okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; paclitaxel analogues; paclitaxel derivatives; palauamine; palmitoylrhizoxin; pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine; pegaspargase; peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfosfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors; picibanil; pilocarpine hydrochloride; pirarubicin; piritrexim; placetin A; placetin B; plasminogen activator inhibitor; platinum complex; platinum compounds; platinum-triamine complex; podophyllotoxin; porfimer sodium; porfiromycin; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor; protein kinase C inhibitors, microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylene conjugate; raf antagonists; raltitrexed; ramosetron; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone B1; ruboxyl; safingol; saintopin; SarCNU; sarcophytol A; sargramostim; Sdi 1 mimetics; semustine; senescence derived inhibitor 1; sense oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen binding protein; sizofiran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D; spiromustine; splenopentin; spongistatin 1; squalamine; stem cell inhibitor; stem-cell division inhibitors; stipiamide; stromelysin inhibitors; sulfinosine; superactive vasoactive intestinal peptide antagonist; suradista; suramin; swainsonine; synthetic glycosaminoglycans; tallimustine; tamoxifen methiodide; tauromustine; tazarotene; 24 WO 2011/012713 PCT/EP2010/061152 tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfin; temozolomide; teniposide; tetrachlorodecaoxide; tetrazomine; thaliblastine; thalidomide; thiocoraline; thrombopoietin; thrombopoietin mimetic; thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene dichloride; topotecan; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine; triciribine; trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors; tyrphostins; UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfin; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer. Chemotherapeutic agent supplementary potentiating agents are for example tricyclic anti depressant drugs (e.g., imipramine, desipramine, amitryptyline, clomipramine, trimipramine, doxepin, nortriptyline, protriptyline, amoxapine and maprotiline); non-tricyclic anti-depressant drugs (e.g., sertraline, trazodone and citalopram); Ca.sup.++ antagonists (e.g., verapamil, nifedipine, nitrendipine and caroverine); Calmodulin inhibitors (e.g., prenylamine, trifluoroperazine and clomipramine); Amphotericin B; Triparanol analogues (e.g., tamoxifen); antiarrhythmic drugs (e.g., quinidine); antihypertensive drugs (e.g., reserpine); Thiol depleters (e.g., buthionine and sulfoximine) and Multiple Drug Resistance reducing agents such as Cremaphor EL. The compounds of the invention also can be administered with cytokines such as granulocyte colony stimulating factor. An antiproliferative agent is for example Piritrexim Isethionate. Example of Radioactive agents are Fibrinogen I 125; Fludeoxyglucose F 18 ; Fluorodopa F 18; Insulin I 125; Insulin I 131; Iobenguane I 123; Iodipamide Sodium I 131; Iodoantipyrine I 131; Iodocholesterol I 131; Iodohippurate Sodium I 123; Iodohippurate Sodium I 125; Iodohippurate Sodium I 131; Iodopyracet I 125; Iodopyracet I 131; Iofetamine Hydrochloride I 123; Iomethin I 125; Iomethin I 131; Iothalamate Sodium I 125 Iothalamate Sodium I 131; Iotyrosine I 131; Liothyronine I 125; Liothyronine I 131; Merisoprol Acetate Hg 197; Merisoprol Acetate Hg 203; Merisoprol Hg 197; 25 WO 2011/012713 PCT/EP2010/061152 Selenomethionine Se 75; Technetium Tc 99m Antimony Trisulfide Colloid; Technetium Tc 99m Bicisate; Technetium Tc 99m Disofenin; Technetium Tc 99m Etidronate; Technetium Tc 99m Exametazime; Technetium Tc 99m Furifosmin; Technetium Tc 99m Gluceptate; Technetium Tc 99m Lidofenin; Technetium Tc 99m Mebrofenin; Technetium Tc 99m Medronate; Technetium Tc 99m Medronate Disodium; Technetium Tc 99m Mertiatide; Technetium Tc 99m Oxidronate; Technetium Tc 99m Pentetate; Technetium Tc 99m Pentetate Calcium Trisodium; Technetium Tc 99m Sestamibi; Technetium Tc 99m Siboroxime; Technetium Tc 99m Succimer; Technetium Tc 99m Sulfur Colloid; Technetium Tc 99m Teboroxime; Technetium Tc 99m Tetrofosmin; Technetium Tc 99m Tiatide; Thyroxine I 125; Thyroxine I 131; Tolpovidone I 131; Triolein I 125; Triolein I 131. Active derivatives of the chemotherapeutic agents as well as prodrugs are also part of this invention. Since a common but tolerable side effect of chemotherapeutic agents is nausea and vomiting, it is obvious to someone skilled in the art that these effects are avelliatably by administering an anti-emetic in conjunction with the chemotherapeutic agent inducing nausea and/or vomiting. E.g. Ondansetron may be given p.o. in a dose of about 8 mg about 30 minutes before the nausea/vomiting inducing antineoplastic agent is administered. Of course other anti-emtics such as Hasaldol, Benadryl, and Ativan may also be used as needed. Therefore, in an alternative embodiment, the pharmaceutical composition of the present invention comprises further compounds to decrease side effects of the chemotherapeutic agent or the inhibitor of the TGF-beta system. Radiation is applied in dosages of about 1 Gy to about 100 Gy, more preferred from about 20 to about 80 Gy and most preferred, e.g. for the treatment of astrocytomas, glioblastomas and gliomas from about 40 to about 60 Gy. The dosage in preferred embodiments is fractionated which means that, from about 0.1 to about 10 Gy or from about 1 Gy to about 5 Gy or from about 1 Gy to about 2 Gy are applied in one session which is repeated several times during about 1 to about 20 weeks, about 2 to 26 WO 2011/012713 PCT/EP2010/061152 about 10 weeks or 4 to about 8 weeks. The chemotherapeutic agent and/or the inhibitor of the TGF-beta system, e.g., an antisense oligonucleotide is administered before, after or together with the radiation. One cycle of radiation therapy as well as several cycles of radiation are possible, dependent of the reduction of tumor size. The radiation usually is performed with 60 Co. Radiation with neutrons, protons, negative pi mesones or neutrone capture is applicable as well. It is clear to someone skilled in the art that the dosage is further dependant on the size of the tumor, the build of the patient and the kind of radiation applied. In special embodiments the dosage is about 2 to about 100 fold higher or lower as described above also dependant from the number of fractions the dosage is applied with. In another embodiment the pharmaceutical composition comprising at least one chemotherapeutic agent and at least one inhibitor of the TGF-beta system such as an antisense oligonucleotide is used in combination with other procedures for the treatment of diseases. For example, a tumor may be treated conventionally with surgery and/or radiation and then the composition comprising the chemotherapeutic agent and at least one antisense oligonucleotide and/or at least one inhibitor of the TGF-beta system according to this invention is subsequently administered to the patient to extend the dormancy of micrometastases and to stabilize respectively reduce any residual neoplastic disease, i.e., a tumor. In a preferred embodiment, the pharmaceutical composition comprising at least one chemotherapeutic agent and at least one inhibitor of the TGF-beta system, for example an antisesne oligonucleotide is administered to a site likely to harbor a metastatic lesion (that may or may not be clinically discernible at the time). A sustained release formulation implanted specifically at the site (or the tissue) where the metastatic lesion is likely to be is suitable in these latter instances. The embodiments of the pharmaceutical composition comprising at least one chemotherapeutic agent and at least one inhibitor of the TGF-beta system such as an 27 WO 2011/012713 PCT/EP2010/061152 antisense oligonucleotide, for example a TGF-beta 2 antisense oligonucleotide such as SEQ ID No. 30 administered in an effective amount. In general, the term "effective amount" of a pharmaceutical composition, a chemotherapeutic agent, and an inhibitor of the TGF-beta system, respectively, refers to the amount necessary or sufficient to realize a desired biologic effect. This depends amongst others on the mode of delivery (e.g., local or systemic), time period of the dosage, age, weight, general health, sex and diet of the subject receiving the pharmaceutical composition. Specifically, the effective amount is that amount that reduces the rate or inhibits altogether formation of neoplastis diseases. For instance, when the subject bears a tumor, an effective amount is that amount which decreases or eliminates the neoplastic disease. Additionally, an effective amount may be that amount which prevents an increase or causes a decrease in new neoplastic diseases. The effective amount varies depending upon whether the composition is used in single or multiple dosages. Dosages given in this writing are for adults. It is quite clear to someone skilled in the art that these dosages have to be adapted if the human being is a child, a person stressed by a further illness or other circumstances. In one embodiment subject doses of the compounds described herein typically range from about 0.1 pg to about 10 mg per administration, which depending on the application could be given hourly, daily, weekly, or monthly and any other amount of time therebetween. In yet another embodiment the doses range from about 10 pg to about 5 mg per administration or from about 100 pg to about 1 mg, with 1-10 administrations being spaced hours, days or weeks apart. In some embodiments, however, doses may be used in a range even 2 to 100 fold higher or lower than the typical doses described above. These doses are mainly referring to the treatment of adults; in case of the treatment of a child, the doses have to be reduced as known by a skilled person. The effect of a compound is indicated for example by its IC 50 , the half maximal inhibitory concentration, which represents the concentration of an inhibitor that is required for 50 % inhibition of its target, i.e., it measures how much of a particular substance/molecule is needed to inhibit some biological process by 50 %. According to the present invention, the IC 50 of the chemotherapeutic agent describes the concentration of the chemotherapeutic 28 WO 2011/012713 PCT/EP2010/061152 agent that results in 50 % cytotoxicity. The IC 50 describes the efficiency of a compound, the lower the IC 50 of a compound, the more effective the compound. In a preferred embodiment, the antisense oligonucleotide, in particular the antitumoral antisense oligonucleotide such as TGF-beta 1, -2, or -3 leads to a 1.5x, 2x, 2.5x, 5x, 5.5x, 6x, 6.5x, 7x, 7.5x, 8x, 8.5x, 9x, 9.5x, 10x, 15x, 20x, 25x, 30x, 35x, 40x, 45x, 50x, 55x, 60x, 65x, 70x, 75x, 80x, 85x, 90x, 95x, or 99x reduction of the IC 50 of the chemotherapeutic agent, preferably gemcitabine. Preferably, the IC 50 of the chemotherapeutic agent such as gemcitabine or temozolomide is 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% reduced by the antisense oligonuclotide, e.g., a TGF-beta 1, -2, and/or -3 antisense oligonucleotide, and/or an inhibitor of the TGF-beta system in comparison to gemcitabine without an antisense oligonucleotide, particularly a TGF-beta 1, -2, and/or -3 antisense oligonucleotide. The reduction of the IC 50 of the chemotherapeutic agent allows reaching the same cytotoxic effect with a lower concentration of the chemotherapeutic agent, or an increased cytotoxic effect with the same concentration of the chemotherapeutic agent. In a preferred embodiment, the inhibitor of the TGF-beta system reduces the IC 50 of the chemotherapeutic agent in a dose dependent manner. Surprisingly, the chemotherapeutic agent does neither influence the expression or activity of the target of the inhibitor of the TGF-beta system such as the antisense oligonucleotide, which lead to the IC 50 reduction of the chemotherapeutic agent, nor the interaction of the the inhibitor of the TGF-beta system, e.g., the antisense oligonucleotide with the target. The chemotherapeutic agent even supports and increases the interaction of the inhibitor of the TGF-beta system, e.g., the antisense oligonucleotide, with the target. A preferred target of the antisense oligonucleotide is TGF-beta 1, -2, and/or -3. In one embodiment of this invention the at least one inhibitor of the TGF-beta system, in particular the TGF-beta 1, -2, or -3 antisense oligonucleotide is administered in a dose range from about 1 pg/kg/day to about 100 mg/kg/day or from about 10 pg/kg/day to about 10 mg/kg/day or from about 100 pg/kg/day to about 1 mg/kg/day. 29 WO 2011/012713 PCT/EP2010/061152 In a further preferred embodiment, the pharmaceutical composition is administered with a catheter directly into the tumor. The concentrations of the antinsense oligonucleotides are from about 0.1 pM/L to about 1 M/L, more preferred from about 1 pM/L to about 500pM/L and even more preferred from about 10 to about 200 pM/L or from about 50 pM/L to about 150 pM/L in a steril aqueous solution. In yet another preferred embodiment this solution is administered with a flow of about 0.1 pL/min to about 50 pL/min or about 2 pL/min to about 12 pL/min or about 3 pL/min to about 10 pL/min into the tumor. In yet another embodiment the at least one chemotherapeutic agent is selected from the group of nitrosourea, more preferred BCNU, CCNU and/or ACNU in combination with at least an inhibitor of the TGF-beta system, e.g., an antisense oligonucleotide such as TGF-betal, beta2- or -beta3 antisense oligonucleotide. The chemotherapeutic agent such as gemcitabine or temozolomid is for example administerd in a dose range from about 1 mg/m 2 to about 1000 mg/m 2 , more preferred in a dose of about 50 mg/m 2 to about 500 mg/m 2 and most preferred in a single dose of about 150 mg/m 2 to 200 mg/m 2 intravenously every 6 weeks. It may be given as a single dose or divided into daily injections such as about 75 mg/m 2 to about 100 mg/m 2 on two successive days. In yet another embodiment in the treatment of neoplastic diseases the chemotherapeutic agent is gemcitabine and is administered with at least an inhibitor of the TGF-beta system such as an antisense oligonucleotide, and/or radiation at a dosage of about 10 mg/m 2 to about 10 g/m 2 , more preferred from about 100 mg to about 5g/m 2 and most preferred from about 500 mg/m 2 to about 2000 mg/m 2 . Gemcitabine is preferably administered within about 10 min to about 120 min, more preferred within about 15 min to about 60 min and most preferred within about 20 min to about 40 min. before or after administration of the antisense oligonucleotides. In a most preferred embodiment, gemcitabine is coadministered with one or more antisense oligonucleotides at the same time, wherein gemcitabine and the antisense oligonucleotide such as SEQ ID No. 30 are administered separately or in combination. In a preferred embodiment a single dose of the chemotherapeutic agent such as gemcitabine is 30 WO 2011/012713 PCT/EP2010/061152 administered repeatedly within about 4 to about 10 days, respectively about 5 to about 8 days and most preferred within about 7 days. About 1 to about 8, more preferred about 2 to about 6 most preferred about 3 to about 4 single doses are administered within about 4 to about 10 days, respectively about 5 to about 8 days and most preferred within about 7 days.. After this a therapy free interval of about 2 to about 60 days, more preferred about 5 to about 30 days and most preferred from about 10 to about 20 days is applied. Several repetitions of these cycles are possible, e.g., 1 to 10, 2 to 10, 3 to 10, 4 to 10, 5 to 10, 6 to 10, 7 to 10, 8 to 10, or 9 or 10. In yet another embodiment at least one chemotherapeutic agent is temozolomide and is administered with a total dose of about 500 to about 1200 mg/m 2 , over a period from about 2 to about 28 consecutive days, more preferable over a period of from about 4 to about 7 consecutive days, and most preferably over a period of about 5 consecutive days. Thus, if the total dose is to be about 1000 mg/m 2 administered over a period of about 5 days, the daily dose for this period is about 200 mg/m 2 /day. Temozolomide is administered at least once per day. Preferably dosing regimes would be twice per day, three times per day or four times per day. After a period of about 28 to about 42 days, or about 28 to about 35 days, or more preferably 28 days, from the first day of temozolomide administration, another administration cycle may be started. In yet another embodiment the temozolomide may be administered for a much longer period at reduced dosage. For example, the temozolomide is administered more than once daily for up to six weeks at a daily dosage of about 50 mg/m 2 /day to about 150 mg/m 2 , of about 50 mg/m 2 /day to about 75 mg/m 2 /day, most preferably of about 75 mg/m 2 /day. More preferred these daily doses are split about evenly into two or more doses to be administered two or more times per day. In yet another embodiment vinblastin is administered at a dosage of about 0.1 mg/m 2 to about 50 mg/m 2 more preferred in a dose of about 1 mg/m 2 to about 10 mg/m 2 and even more preferred at about 4 mg/m 2 to about 8 mg/m 2 . 31 WO 2011/012713 PCT/EP2010/061152 In a further embodiment vincristin is administered at a dose of about 0.1 mg/m 2 to 10 mg/m 2 more preferred in a dose of about 0.5 mg/m 2 to about 5 mg/m 2 and more preferred at about 0.8 mg/m 2 to about 2 mg/m 2 about once a week whereas the neurotoxicity is the dosage limiting factor. Most commonly solution of vincristin sulfate from about 0.1 mg/mL to about 10 mg/mL are administered with single doses of about 0.1 mg/m 2 to about 50 mg/m 2 more preferred in a dose of about 0.5 mg/m 2 to about 10 mg/m 2 and even more preferred from about 1 mg/m 2 to about 5.0 mg/m 2 . In one embodiment, a pharmaceutical composition for the treatment of pancreas carcinoma, glioblastoma and/or anaplastic astrocytoma comprises a combination of at least one antisense oligonucleotide, e.g., a TGF-beta 1, -2, and/or -3 antisense oligonucleotide, preferably a TGF-beta antisense oligonucleotide of SEQ ID NO. 1 to 78, and a chemotherapeutic agent preferably selected from the group consisting of temozolomide, ACNU, BCNU, CCNU, vinblastine, vincristine, vindesine and their active derivatives, 5 fluorouracile, 5-fluorodeoxiuridine, cytarabine, gemicitabine, liposomal pegylated doxorubicine, procarbazine and vincristin. In another embodiment the chemotherapeutic agents procarbazine, CCNU and vincristin are administered together with an antisense oligonucleotide identified in the sequence listing under SEQ ID NO. 1-127 and even more preferred in SEQ ID NO. 22-48, and/or an inhibitor of the TGF-beta system. The dosage in this embodiment is about 40 mg/m 2 to about 80 mg/m 2 of procarbazine p.o. (days about 8 to about 21 from the beginning of administration), about 80 to about 120 mg/m 2 CCNU, p.o. (about day 1 of administration), vincristine from about 1.2 mg/m 2 to about 1.8 mg/m 2 p.o. (day 1 of administration) with a maximum of about 2 mg/m 2 i.v. at about day 8, and about day 29 (from the beginning of administration). The antisense oligonucleotide and/or the inhibitor of the TGF-beta system is given before, with or after the administration of the chemotherapeutic agent, i.e., in general the compounds of the pharmaceutical composition of the present invention are administered at the same time, timely overlapping, or timely distinct. In another embodiment this cycle is repeated after about 6 to about 8 weeks once or several times. 32 WO 2011/012713 PCT/EP2010/061152 In a further preferred embodiment the at least one antisense oligonucleotide, even more preferred an antisense oligonucleotid of TGF-beta 1, -2, or -3, and most preferred, an antisense oligonucleotide identified in the sequence listing under SEQ ID NO. 1-127 and even more preferred the sequences with SEQ ID NO. 22-48 and telozolomide are the parts of the pharmaceutical composition. In this case the dosage of temozolomide for the treatment of a neoplastic disease, more preferred cancer such as pancreatic carcinoma, glioma, glioblastoma and/or anaplastic astrocytoma is from about 120 to about 180 mg/m 2 , p.o. on day 1 to 5 of a cycle. In a more preferred embodiment the antisense oligonucleotide is administered from about 1 pg/kg/day to about 50 mg/kg/day. The cycle is repeated after about 3 to 5 weeks. In a further preferred embodiment for the treatment of glioma, radiation is further administered according to standard schedules as described above. In one embodiment the radiation is applied together with the administration of the combination as described above. In other embodiments the radiation is applied before or after the administration of the pharmaceutical compositions according to this invention. In one embodiment of pharmaceutical compositions for the treatment of neoplastic diseases, more preferred pancreatic neoplasms at least one chemotherapeutic agent inhibiting cell proliferation and/or inducing cell death is selected from the group of cisplatin, carboplatin, cyclophosphamid, docetaxel, PEG-liposomal doxorubicin, etoposid, folinicc acid, 5 fluorouracil, mitoxantrone, paclitaxel, topotecan and/or treosulfan. In more preferred embodiments for the treatment of neoplastic diseases the chemotherapeutic agents paclitaxel or carboplatin are the at least one part of a pharmaceutical composition according to this invention. Paclitaxel from about 100 mg/m 2 to about 200 mg/m 2 more preferred about 175 mg/m 2 or carboplatin administered i.v. at day 1 of a cycle. This cycle is repeated after about 20 to about 30 days. In yet another embodiment for the treatment of neoplastic diseases such as pancreatic carcinoma the at least one chemotherapeutic agent of a pharamaceutical composition according to this invention is gemcitabine. Gemcitabine is administered in dosages of about 33 WO 2011/012713 PCT/EP2010/061152 800 mg/m 2 to about 1200 mg/m 2 , more preferred about 1000 mg/m 2 i.v. within about 10 min to about 60 min, more preferred within about 12 min to about 20 min. This application is repeated for about 5 to about 10 days. In yet other embodiments paclitaxel together with carboplatin, docetaxel together with carboplatin, carboplatin together with cyclophosphamid, cisplatin together with treosulfan, etoposid, mitoxantron together with folin acid and 5-fluorouracil, topotect, or PEG-liposomal doxorubicin are the at least one chemotherapeutic agent of a pharamaceutical composition according to this invention for the treatment of pancreatic cancer. In a more preferred embodiment of the above mentioned embodiments for the treatment of pancreatic cancer the antisense oligonucleotide is an oligonucleotide identified in the sequence listing under SEQ ID NO. 1-127 and even more preferred the sequence with SEQ ID NO. 22-48. In a further preferred embodiment, the antisense oliogonucleotide is administered in a dose of 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 tM. In another embodiment further to the adminstration of these pharmaceutical compositions, radiotherapy is applied according to standard schedules as described above. Alternatively, to the local administration of the pharmaceutical composition of the present invention, the composition is administered systemically in a preferred embodiment. The pharmaceutical composition of the present invention preferably comprises at least one chemotherapeutic agent such as gemcitabine or temozolomide and at least one inhibitor of the TGF-beta system such as a TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, forming the components of the pharmaceutical composition. These components are either in pure form mixed together, or together with a pharmaceutically acceptable carrier, lubricant, diluent, excipient, disintegrate, and/or adjuvant mixed together. In an alternative embodiment the components of the pharmaceutical composition are separate, either in pure 34 WO 2011/012713 PCT/EP2010/061152 form, or together with a pharmaceutically acceptable carrier, lubricant, diluent, excipient, disintegrate, and/or adjuvant. In a preferred embodiment, the pharmaceutically acceptable carrier, lubricant, diluent, excipient, disintegrate, and/or adjuvant of the components is identical or different. "Administering" the pharmaceutical compositions of the present invention is accomplished by any means known to a person skilled in the art. Routes of administration include but are not limited to oral, intranasal, intratracheal, ocular, pulmonal, vaginal, rectal, parenteral (e.g. intramuscular, intradermal, intravenous, intratumoral or subcutaneous or direct injection), depo injection, implantation, time-release mode, intracranial, intraperitoneal, intravesical, subconjunctival, topical, transdermal, or sublingual. In one embodiment of a pharmaceutical composition for the treatment of neoplastic diseases forming a tumor such as cancer, the combination of at least one chemotherapeutic agent and the at least one inhibitor of the TGF-beta system such as an antisense oligonucleotide are preferably delivered by means of a biodegradable, polymeric implant or implanted catheter. The term "pharmaceutical composition" refers to compositions comprising the components in solid and/or liquid form, wherein the components are in pure form and/or together with a pharmaceutically acceptable carrier, filler, lubricant, diluent, excipient, disintegrate, and/or adjuvant. Pharmaceutical acceptable carrier, filler, lubricant, diluent, excipient, disintegrate, and/or adjuvant according to the present invention is any substance suitable for administration to a subject, which are of organic or inorganic origin, natural or synthetic origin, and with which a component of the pharmaceutical composition is for example combined to facilitate the application, or to increase the efficiency of the component. Preferably, a carrier, filler, lubricant, diluent, excipient, disintegrate, and/or adjuvant enables the components of the pharmaceutical composition or the pharmaceutical composition to be formulated as tablet, coated tablet, evervescent tablet, granules, lozenge, powder, pill, dragee, (micro)capsule, liquid, gel, syrup, slurry, suspension, emulsion and the like, for oral ingestion by a subject to 35 WO 2011/012713 PCT/EP2010/061152 be treated. The pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops, coated onto microscopic gold particles or preparations with protracted release of the components, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above. For a brief review of present methods for drug delivery, see Langer (1990). In one embodiment pharmaceutical preparations for oral use are obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP). In yet another embodiment disintegrating agents are added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Optionally the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions. In yet another embodiment dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. In yet another embodiment dyestuffs or pigments are added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses. In another embodiment pharmaceutical preparations, which can be used orally "vegicaps" include push-fit capsules made of gelatin, as well as soft, sealed capsules made 36 WO 2011/012713 PCT/EP2010/061152 of gelatin and a plasticizer, such as glycerol or sorbitol. In one embodiment the push-fit capsules containes the active ingredient in a mixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In another embodiment of the soft capsules, the active compounds are dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. In yet another embodiment microspheres formulated for oral administration are used, wellknown to someone skilled in the art. The formulations for oral administration are in dosages suitable for such administration. In yet another embodiment for buccal administration, the compositions take for example the form of tablets or lozenges formulated in conventional manner. In yet another embodiment for the administration by inhalation, the compounds for use according to the present invention may be conveniently delivered in the form of an aerosol spray, from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g. gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch. Suitable pharmaceutical carriers are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, contained in liposomes, nebulized, aerosols. In yet another embodiment the pharmaceutical acceptable carriers of the compounds, e.g., for oral, intravenous, intracaranial, intraperitoneal, intravesicel, topical, transdermal, subconjunctival, sublingual, parenteral, depo injection, time-release mode, intrathecal, intraventricular or intratumoral administration include sterile aqueous solutions which may also contain buffers, diluents and other suitable additives such as, but not limited to, penetration enhancers, carrier compounds and other pharmaceutical acceptable carriers, fillers, lubricants, diluents, excipients, disintegrates, and/or adjuvants. In yet another embodiment for the systemic delivery of the pharmaceutical composition or 37 WO 2011/012713 PCT/EP2010/061152 its components, they are for example together with a pharmaceutical carrier, filler, lubricant, diluent, excipient, disintegrate, and/or adjuvant for parenteral administration by injection (e.g., by bolus injection or continuous infusion). Formulations for injection are for example presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. Prefreably, the pharmaceutical compositions take such forms amongst others as suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents. In one embodiment pharmaceutical carriers, fillers, lubricants, diluents, excipients, disintegrates, and/or adjuvants for parenteral administration include aqueous solutions of the active compounds in water-soluble form. In yet another embodiment a suspension of one or more components of the pharmaceutcal composition of the invention is prepared as appropriate oily injection suspension. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions comprise substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents, which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. In yet another embodiment the chemotherapeutic agent and/or the inhibitor of the TFG-beta system, e.g., an antisense oligonucleotide is in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use or dried onto a sharp object to be scratched into the skin. In yet another embodiment the compounds are formulated in rectal or vaginal compositions such as suppositories or retention enemas or tablets, e.g., containing conventional suppository bases such as cocoa butter or other glycerides. In yet another embodiment the compounds are formulated as a depot preparation. In one embodiment such long acting formulations are formulated with suitable polymeric or 38 WO 2011/012713 PCT/EP2010/061152 hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example as a sparingly soluble salt. In other embodiments delivery systems include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art. In an alternative embodiment the delivery systems include polymer base systems such as poly(lactide glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109. In another embodiment the delivery systems include non-polymer systems that are e.g. lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di- and triglycerides; hydrogel release systems; sylastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which an agent of the invention is contained in a form within a matrix such as those described in U.S. Pat. No. 4,452,775, 4,675,189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. No. 3,854,480, 5,133,974 and 5,407,686. In addition, preferably pump-based hardware delivery systems are used, some of which are adapted for implantation. In a further embodiment, the chemotherapeutic agent and/or the antisense oligonucleotide and/or the inhibitor of the TGF-beta system is formulated with GELFOAM®, a commercial product consisting of modified collagen fibers that degrade slowly. Moreover, the pharmaceutical compositions also comprise for example suitable solid or gel phase carriers, fillers, lubricants, diluents, excipients, disintegrates, and/or adjuvants. Examples of such carriers, fillers, lubricants, diluents, excipients, disintegrates, and/or adjuvants include, but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols. 39 WO 2011/012713 PCT/EP2010/061152 Preferably the chemotherapeutic agent and/or the antisense oligonucleotide and/or the inhibitor of the TGF-beta system is administered neat or in the form of a pharmaceutical acceptable salt. The salts have to be pharmaceutical acceptable, but non-pharmaceutical acceptable salts may conveniently be used to prepare pharmaceutical acceptable salts thereof. Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2 sulphonic, and benzene sulphonic. Also, such salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group. In one embodiment suitable buffering agents include but are not limited to: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v). Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3-0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v). In one embodiment the pharmaceutically acceptable carrier for topical administration for the at least two components of a pharmaceutical composition according to this invention include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable. In yet another embodiment coated condoms, gloves and the like are useful. In yet another embodiment the pharmaceutical compositions include penetration enhancers in order to enhance the alimentary delivery. Penetration enhancers may be classified as belonging to one of five broad categories, i.e., fatty acids, bile salts, chelating agents, surfactants and non-surfactants (Lee et al. 1991, Muranishi 1990). Preferably, one or more penetration enhancers from one or more of these broad categories are included. Various fatty acids and their derivatives which act as penetration enhancers include, for example, oleic acid, lauric acid, capric acid, myristic acid, palmitic acid, stearic acid, linoleic acid, linolenic acid, dicaprate, tricaprate, recinleate, monoolein (a.k.a. 1-monooleoyl-rac-glycerol), dilaurin, caprylic acid, arichidonic acid, glyceryl 1-monocaprate, 1-dodecylazacycloheptan-2-one, acylcarnitines, acylcholines, mono 40 WO 2011/012713 PCT/EP2010/061152 and di-glycerides and physiologically acceptable salts thereof (i.e., oleate, laurate, caprate, myristate, palmitate, stearate, linoleate, etc.) (Lee et al. 1991, Muranishi 1990, El-Hariri et al. 1992). Examples of some presently preferred fatty acids are sodium caprate and sodium laurate, used singly or in combination at concentrations of 0.5 to 5%. The physiological roles of bile include the facilitation of dispersion and absorption of lipids and fat-soluble vitamins (Brunton 1996). Various natural bile salts, and their synthetic derivatives, act as penetration enhancers. Thus, the term "bile salt" includes any of the naturally occurring components of bile as well as any of their synthetic derivatives. A presently preferred bile salt is chenodeoxycholic acid (CDCA) (Sigma Chemical Company, St. Louis, Mo.), generally used at concentrations of 0.5 to 2%. In a preferred ambodiment, complex formulations comprising one or more penetration enhancers are used. For example, bile salts are used in combination with fatty acids to make complex formulations. Preferred combinations include CDCA combined with sodium caprate or sodium laurate (generally 0.5 to 5%). In one embodiment additionally chelating agents are used that include, but are not limited to, disodium ethylenediaminetetraacetate (EDTA), citric acid, salicylates (e.g., sodium salicylate, 5-methoxysalicylate and homovanillate), N-acyl derivatives of collagen, laureth-9 and N-amino acyl derivatives of beta-diketones (enamines) (Lee et al. 1991; Muranishi 1990; Buur et al. 1990). Chelating agents have the added advantage of also serving as DNase inhibitors. In yet another embodiment additionally surfactants are used. Sufactants include, for example, sodium lauryl sulfate, polyoxyethylene-9-lauryl ether and polyoxyethylene-20 cetyl ether (Lee et al. 1991); and perfluorochemical emulsions, such as FC-43 (Takahashi et al. 1988). Non-surfactants include, for example, unsaturated cyclic ureas, 1-alkyl- and 1 alkenylazacyclo-alkanone derivatives (Lee et al. 1991); and non-steroidal anti-inflammatory agents such as diclofenac sodium, indomethacin and phenylbutazone (Yamashita et al. 1987). In one embodiment the pharmaceutical compositions of the present invention additionally contain other adjunct components conventionally found in pharmaceutical compositions, at 41 WO 2011/012713 PCT/EP2010/061152 their art-established usage levels. Thus, for example, the compositions may contain additional compatible pharmaceutically active materials such as, e.g., antipruritics, astringents, local anesthetics or anti-inflammatory agents, or may contain additional materials useful in physically formulating various dosage forms of the composition of present invention, such as dyes, flavoring agents, preservatives, antioxidants, opacifiers, thickening agents and stabilizers. However, such materials, when added, should not unduly interfere with the biological activities of the components of the compositions of the invention. Examples The present invention is demonstrated in the following examples, however, the invention is not limited to these examples. Example 1 TGF-beta 2 antisense oligonucleotide reducing the IC 50 of gemcitabine (Fig. 1) In a 96-well tissue culture plate 4000 cells/well of a human pancreatic tumor cell line Hup T3 (German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany) were seeded. The Hup-T3 cell line is not resistant to gemcitabine. One day after seeding, cells were co-treated with eight different gemcitabine concentrations, i.e., 5 pM, 2 pM, 800 nM, 320 nM, 128 nM, 51.2 nM, 20.5 nM, 8.2 nM, 3.3 nM and 0 nM gemcitabine, respectively, in combination with 0 pM (m), 5 pM (A) or 10 pM (7) TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, for 5 h. Thereafter the first treatment solution comprising gemcitabine and the TGF-beta 2 antisense oligonucleotide was removed and replaced by a second treatment solution containing the TGF-beta 2 antisense oligonucleotide, but no gemcitabine. The treatment solution was optionally replaced after 3 days. After 7 days of total treatment, cell supernatants were removed and the TGF-beta 2 concentration was analyzed (see Example 4, and Fig. 4). The proliferation/viability of the Hup-T3 cells was analyzed using the EZ4U method according to the manufacturer's instructions (Biozol Diagnostca Vertrieb GmbH), and the OD was 42 WO 2011/012713 PCT/EP2010/061152 measured after an incubation time of 75 min with EZ4U solution using the plate reader "Fluostar-Optima" (BMG LABTECH GmbH). The results show an unexpected increase in the inhibition of cell proliferation by gemcitabine, when gemcitabine was administered in combination with the TGF-beta 2 antisense oligonucleotide. Thus, the TGF-beta 2 antisense oligonucleotide surprisingly reduced the IC 50 of gemcitabine in a dose dependent manner (Fig. 1). Example 2 Effect of gemcitabine on TGF-beta 2 secretion (Fig. 2) The effect of gemcitabine on TGF-beta 2 expression and secretion, respectively, was investigated on Hup-T3 cells. Gemcitabine was administered to the Hup-T3 cells in following concentrations: 5 pM, 0.5 pM, 50 nM, 5 nM, 0.5 nM, 0.05 nM or 0 nM, and the cells were incubated for 5 h according to Example 1. The treatment solution was optionally replaced after 3 days. After 7 days of treatment, cell supernatants were removed for the analysis of TGF-beta 2 concentration. The TGF-beta 2 secretion (A) was quantified by a standard TGF-beta 2-ELISA Kit (R&D Systems, Minneapolis, USA) according to the manufacturer's instructions. The proliferation/viability of the Hup-T3 cells (m) was analyzed using the EZ4U method according to the manufacturer's instructions (Biozol Diagnostca Vertrieb GmbH), and the OD was measured after an incubation time of 75 min with EZ4U solution using the plate reader "Fluostar-Optima" (BMG LABTECH GmbH). The decrease of TGF-beta 2 secretion (A) correlates to the proliferation and viability (i), respectively, of the cells, which decreases at higher gemcitabine concentrations due to the cytotoxic effect of gemcitabine. This is shown by the overlapping curves of Fig. 2. Surprisingly, gemcitabine has a cytotoxic effect, but does not specifically influence the TGF beta 2 secretion of Hup-T3 cells (A) (see Fig. 2). 43 WO 2011/012713 PCT/EP2010/061152 Example 3 Effect of the TGF-beta 2 antisense oligonucleotide on TGF-beta 2 secretion (Fig. 3) In a further experiment the effect of the TGF-beta 2 antisense oligonucleotide on the expression and secretion, respectively, of TGF-beta 2 was investigated on Hup-T3 cells. The TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, was administered to the Hup-T3 cells as described in Example 1 (0 pM, 1 pM, 2.5 pM, 5 pM, 10 pM, 20 pM, 40 pM, 60 pM, or 80 pM TGF-beta 2 antisense oligonucleotide). The cells were incubated according to Example 1 and after 7 days of treatment, the cell supernatants were removed for the analysis of TGF-beta 2 concentration using the TGF-beta 2-ELISA Kit of R&D Systems. As expected, the TGF-beta 2 antisense oligonucleotide inhibited the TGF-beta 2 expression and secretion, respectively, in a dose dependent manner (see Fig. 3). Example 4 Effect of gemcitabine on the suppression of TGF-beta 2 secretion by TGF-beta 2 antisense oligonucleotide (Fig. 4) Hup-T3 cells were incubated with different concentrations of gemcitabine (2 pM, 800 nM, 320 nM, 128 nM, 51.2 nM, 20.5 nM, 8.2 nM, and 0 nM) and TGF-beta 2 antisense oligonucleotide according to Example 1 (0 pM (m), 5 pM (A), or 10 pM (-) TGF-beta 2 antisense oligonucleotide) and the cell supernatants were removed after 7 days of treatment for the analysis of TGF-beta 2 concentration using the TGF-beta 2-ELISA Kit of R&D Systems. Surprisingly, gemcitabine does not negatively influence the interaction of TGF-beta 2 antisense oligonucleotide with its TGF-beta 2 target, i.e., gemcitabine does not impair the suppression of TGF-beta 2 secretion via the TGF-beta 2 antisense oligonucleotide. Example 5 44 WO 2011/012713 PCT/EP2010/061152 TGF-beta 2 antisense oligonucleotide reducing the ICso of temozolomide (Fig. 5) In a 48-well tissue culture plate 10 000 cells/well of a human melanoma cell line MEL-Juso (CLS- Cell Lines Service, Eppelheim, Germany) were seeded. The MEL-Juso cell line is not resistant to temozolomide. Six hours after seeding, cells were co-treated with eight different temozolomid concentrations, i.e., 200 pM, 100 pM, 50 pM, 25 pM, 12.5 pM, 6.25 pM, 3.125 pM, and 0 pM temozolomide, respectively, in combination with 0 pM (i), 5 pM (A) or 10 pM (7) TGF-beta 2 antisense oligonucleotide, for example SEQ ID No. 30, for 2 days. Substances (temozolomide and TGF-beta 2 antisense oligonucleotide) were prepared in aqueous solution, stored at 41C and were used for 4 weeks. Thereafter the first treatment solution comprising temozolomidee and the TGF-beta 2 antisense oligonucleotide was removed and replaced by a second treatment solution containing the TGF-beta 2 antisense oligonucleotide and temozolomide in the above mentioned concentrations for further 2 days. The treatment solution containing the TGF-beta 2 antisense oligonucleotide and temozolomide was removed, and fresh test solution was added to the cells for further 3 days. After 7 days of total treatment, cell supernatants were removed and the TGF-beta 2 concentration was analyzed. The proliferation/viability of the MEL-Juso cells was analyzed using the Cyquant method according to the manufacturer's instructions (Invitrogen), and the OD was measured after an incubation time of 60min with Cyquant solutions (detection reagent, direct nucleic acid stain, and direct nucleic acid background suppressor) using the plate reader "Fluostar Optima" (BMG LABTECH GmbH). The results show an unexpected increase in the inhibition of cell proliferation by temozolomide, when temozolomide was administered in combination with the TGF-beta 2 antisense oligonucleotide. Thus, the TGF-beta 2 antisense oligonucleotide surprisingly reduced the IC 50 of temozolomide in a dose dependent manner (Fig. 5). 45 WO 2011/012713 PCT/EP2010/061152 Example 6 TGF-beta 2 antisense oligonucleotide increasing temozolomide's cytotoxicity (Fig. 6) A-172 cells (about 7000 cells/well) were seeded into 48-well plates, and 6 h after seeding 0 pM, 200 pM, or 800 pM temozolomide either alone (grey column) or in combination with 10 pM of a TGF-beta 2 antisense oligonuclotide (black column), for example SEQ ID No. 30, was added to the cells. After 2d of incubation, the treatment solutions were replaced and cells were incubated for additional 3d (total treatment time: 5d). Thereafter, cell supernatants containing lactate dehydrogenase (LDH) from lysed cells and of cells floating in the supernatant, as a result of treatment induced stress, were removed from the wells. The cells of the supernatant were lysed by addition of lysis solution for example from the CytoToxicity Detection Kit Plus (Roche Diagnostics GmbH) and the LDH levels were determined for example according to the manual of the kit. The amount of released LDH significantly increased with the combination of temozolomide and the TGF-beta 2 antisense oligonucleotide (Fig. 6). Example 7 Antisense m-RNA for the human transforming growth factor TGF-beta 1, -2, and -3: Antisense m-RNA for the human TGF-beta 1: CTGCAGCCTTGACCTCCCAGGATCAAGTGATCCTCCCACCTTAGCCTCCAGAGTAGCTGGGACCACA GGTGTACATTTTTTAAAAGTGTTTTGTAGAGATAGGGTCTCACTATGTTACCCAGGCTGGTCTCAAAT GCCTGGATTCAAGTATCCTCCCATCTCTGCCTCCCAAAAGTGCTAGGATTACAGGCGTGAGCACCCC GCCTGGCCTGAACTACTATCTTTTATTGTCTTCTTCACTATCCCCCACTAAAGCAGGTTCCTGGTGGG CAGGAACTCCTCCCTTAACCTCTCTGGGCTTGTTTCCTCAACCTTTAAAATGGGTGTTATCAGAGTCC CTGCCATCTCAGAGTGTTGCTATGGTGACTGAATGAGTTCATTAATGTAAGGCACTTCAACAGTGCCC AAGGTGCTCAATAAATAGATCTAACTACAGTAGTGTTCCCCACTGGTCCCCTGTGCCTTGATGCCGGG 46 WO 2011/012713 PCT/EP2010/061152 CAAAGGAATAGTGCAGACAGGCAGGAGGAGGCAGAGAGGGAGAGAGAGGGAGTGGGAGTGGGGG AACGTCAGGGATGGAGACCCCAGGCAGGCGCCCAATGACACAGAGATCCGCAGTCCTCTCTCCATCT TTAATGGGGCCCCAGGTGGGCTTGGGGCACGGTGTCCTTAAATACAGCCCCCATGGGCAAGGCAGC GGGGGCGGGGCGGGGTGGGGCCGGGCCTGCCGGGGCGGGGCGGGGCGGGGCGGGACCTCAGCT GCACTTGCAGGAGCGCACGATCATGTTGGACAGCTGCTCCACCTTGGGCTTGCGGCCCACGTAGTAC ACGATGGGCAGCGGCTCCAGCGCCTGCGGCACGCAGCACGGCGCCGCCGAGGCGCCCGGGTTATG CTGGTTGTACAGGGCCAGGACCTTGCTGTACTGCGTGTCCAGGCTCCAAATGTAGGGGCAGGGCCC GAGGCAGAAGTTGGCATGGTAGCCCTTGGGCTCGTGGATCCACTTCCAGCCGAGGTCCTTGCGGAA GTCAATGTACAGCTGCCGCACGCAGCAGTTCTTCTCCGTGGAGCTGAAGCAATAGTTGGTGTCCAGG GCTCGGCGGTGCCGGGAGCTTTGCAGATGCTGGGCCCTCTCCAGCGGGGTGGCCATGAGAAGCAG GAAAGGCCGGTTCATGCCATGAATGGTGGCCAGGTCACCTCGGCGGCCGGTAGTGAACCCGTTGAT GTCCACTTGCAGTGTGTTATCCCTGCTGTCACAGGAGCAGTGGGCGCTAAGGCGAAAGCCCTCAATT TCCCCTCCACGGCTCAACCACTGCCGCACAACTCCGGTGACATCAAAAGATAACCACTCTGGCGAGT CGCTGGGTGCCAGCAGCCGGTTGCTGAGGTATCGCCAGGAATTGTTGCTGTATTTCTGGTACAGCTC CACGTGCTGCTCCACTTTTAACTTGAGCCTCCTCAGCAGACGCAGCTCTGCCCGGGAGAGCAACACG GGTTCAGGTACCGCTTCTCGGAGCTCTGATGTGTTGAAGAACATATATATGCTGTGTGTACTCTGCTT GAACTTGTCATAGATTTCGTTGTGGGTTTCCACCATTAGCACGCGGGTGACCTCCTTGGCGTAGTAGT CGGCCTCAGGCTCGGGCTCCGGTTCTGCACTCTCCCCGGCCACCCGGTCGCGGGTGCTGTTGTACA GGGCGAGCACGGCCTCGGGCAGCGGGCCGGGCGGCACCTCCCCCTGGCTCGGGGGGCTGGCGAG CCGCAGCTTGGACAGGATCTGGCCGCGGATGGCCTCGATGCGCTTCCGCTTCACCAGCTCCATGTC GATAGTCTTGCAGGTGGATAGTCCCGCGGCCGGCGGGCCAGGCGTCAGCACCAGTAGCCACAGCAG CGGTAGCAGCAGCGGCAGCAGCCGCAGCCCGGAGGGCGGCATGGGGGAGGCGGCGCCCCCCGGC ACTGCCGAGAGCGCGAACAGGGCTGGTGTGGTGGGGAGGCCCCGCCCCTGCAGGGGCTGGGGGTC TCCCGGCAAAAGGTAGGAGGGCCTCGAGGGAAAGCTGAGGCTCCTCAGGGAGAAGGGCGCAGTGG TGGAGGGGAGGCTTGGACCGGGGGTGTCTCAGTATCCCACGGAAATAACCTAGATGGGCGCGATCT GGTACCAGAAGGTGGGTGGTCTTGAATAGGGGATCTGTGGCAGGTCGGAGAGAGATCCGTCTCCTG GAGGAGAAAGGGTCTAGGATGCGCGGGGGCTCAGGAGACAGGCCGGGGATGAAGGCGGCGTGCA GGGGGTGCGCCCGAGGTCTGGGGAAAAGTCTTTGCGGGAGGCCGGGTCGGCGACTCCCGAGGGCT GGTCCGGAATGGGGGCGCCTGAGGGACGCCGTGTAGGGGGCAGGGAGGGAGCAAGCGTCCCCGG CGGCAAAGGGAGGCGGTCTGGGGTCCCCAAGTCCTGCCTCCTCGCGGGGCAGCGTCGCGCCAAGA GGTCCCCGCGCCTCCGGCTCCCAGCGGCAACGGAAAAGTCTCAAAAGTTTTTTCCTCTTCTCCCGA 47 WO 2011/012713 PCT/EP2010/061152 CCAGCTCGTCCCTCCTCCCGCTCCTCCTCCCCCTCCTCCCCGCAGTGGCGGGGGCGGCGGCGGCTC GTCTCAGACTCTGGGGCCTCAGGCTGCTCCTCGGCGACTCCTTCCTCCGCTCCGGGCCGAGGCCGG CCCCGCGGGCGGCTCAGAGCCGGGGGGGGTGCCCCGGACGGGGCGTCCCCCCTGCCCCCGGCCG GGGCCCTCGCTGTCTGGCTGCTCCGCGGAGGGAGGT Antisense m-RNA of the human TGF-beta2: TTTAAAAAAATTTGCTTCTTGTCTCTCTCACTTACAAAGTAGGTGAAATGTAGAATAAGGCCTTCAACT I I I I I I GTGTCAGATGCCAGTTTTAACAAACAGAACACAAACTTCCAAAGTGTCTGAACTAGTACCGC CTTTTCAAAAATTTTTAACACTGATGAACCAAGGCTCTCTTATGTTTTCTTGTTACAAGCATCATCGTT GTCGTCGTCATCATCATTATCATCATCATTGTCATTTTGGTCTTGCCACTTTTCCAAGAATTTTAGCTG CATTTGCAAGACTTTACAATCATATTAGAAAGCTGTTCAATCTTGGGTGTTTTGCCAATGTAGTAGAGA ATGGTTAGAGGTTCTAAATCTTGGGACACGCAGCAAGGAGAAGCAGATGCTTCTGGATTTATGGTAT TATATAAGCTCAGGACCCTGCTGTGCTGAGTGTCTGAACTCCATAAATACGGGCATGCTCCAGCACA GAAGTTGGCATTGTACCCTTTGGGTTCGTGTATCCATTTCCACCCTAGATCCCTCTTGAAATCAATGTA AAGTGGACGTAGGCAGCAATTATCCTGCACATTTCTAAAGCAATAGGCCGCATCCAAAGCACGCTTCT TCCGCCGGTTGGTCTGTTGTGACTCAAGTCTGTAGGAGGGCAATAACATTAGCAGGAGATGTGGGGT CTTCCCACTGTTTTTTTCCTAGTGGACTTTATAGTTTTCTGATCACCACTGGTATATGTGGAGGTGCC ATCAATACCTGCAAATCTTGCTTCTAGTTCTTCACTTTTATTTGGGATGATGTAATTATTAGATGGTAC AAAAGTGCAGCAGGGACAGTGTAAGCTTATTTTAAATCCCAGGTTCCTGTCTTTATGGTGAAGCCATT CATGAACAGCATCAGTTACATCGAAGGAGAGCCATTCGCCTTCTGCTCTTGTTTTCACAACTTTGCTG TCGATGTAGCGCTGGGTTGGAGATGTTAAATCTTTGGACTTGAGAATCTGATATAGCTCAATCCGTTG TTCAGGCACTCTGGCTTTTGGGTTCTGCAAACGAAAGACTCTGAACTCTGCTTTCACCAAATTGGAAG CATTCTTCTCCATTGCTGAGACGTCAAATCGAACAATTCTGAAGTAGGGTCTGTAGAAAGTGGGCGG GATGGCATTTTCGGAGGGGAAGAAGGGCGGCATGTCTATTTTGTAAACCTCCTTGGCGTAGTACTCT TCGTCGCTCCTCTCGCGCTCGCAGGCGGCCGCCCTCCGGCTCGCCTTCTCCTGGAGCAAGTCCCTGG TGCTGTTGTAGATGGAAATCACCTCCGGGGGGACTTCCTCGGGCTCAGGATAGTCTTCTGGGGGACT GGTGAGCTTCAGCTTGCTCAGGATCTGCCCGCGGATCGCCTCGATCCTCTTGCGCATGAACTGGTCC ATATCGAGTGTGCTGCAGGTAGACAGGCTGAGCGCGACCGTGACCAGATGCAGGATCAGAAAAGCG CTCAGCACACAGTAGTGCATTTTTAAAAAAGTGGAAAAAAAAGTTGTTTTAAAAGTCAGAATAAAAA AAAAGAAATCAACAATTCTCAAAGTATAGATCAAGGAGAGTTGTTTGGTTTTTTGTTGTTGTTGTTTGT 48 WO 2011/012713 PCT/EP2010/061152 TTTTGATGCGAAACTTTTGCAAACAATCTAGTCAATGCCCAACAGAAAAACGTATCCTGCTTG Antisense of m-RNA of the human TGF-beta 3 CAGGATGCCCCAAAAATATTTATTTATACAAAGATTTTGAGAGTAATATTCATACTTGTCTTTATACCTC AGTCTATGCGTCTGGGGCCAAGTCACTGTGTGGCACATGTCGAGCTTCCCCGAATGCCTCACATGTT GTCGCACCTGCTTCCAGGAACACCAAATGAACACAGGGTCTTGGAGGGGAAGTGGGGGAAGAACCC ATAATGCCCCAACCCTGCATGGAACCACAATCCAGAAATGTGCATCCTGACCTGGAAGGCGTCTAAC CAAGTGTCCAAGGGGAAATATGATCGAGGGAGAGGTGAGAGGAGGGACCCAGAGGCAGACAGGAG AGGGTTGATTTCCACCCTTTCTTCTGCGTTCAGCATATCCAAAAGGCCCAATACAGTTGATGGGCCAG GAACTGCATGACCTGGATTTTCTCCCTGTAGTGACCCACGATGTTAATTGATGTAGAGGACAGTTTGC AAAAGTAATAGATTTGCCCTTAATCCCAGACAGTATGAGATACAATTCTGGGACTTTGTCTTCGTAAC CTGTCTTTAAAAAAAAAAAAAAATGCTTGCCTTGTATAACATAATCCAGATTCCCTAGAGCAGATGTG GTACAGCAATGAGCAAATCCAACCTCAGATCTGAAGTGTCTTCCAGTCTGGCCCTGACCCAGCCATTC TCTGCCCTTCCTTCTCCCTTTAGGGTAGCCCAAATCCCATTGCCACACAACATCTCAACTTACCATCCC TTTCCTCTATCCCCATCCCCTCTGTCTGCGTCACAGAAAGTCTGTGTGTTCTGAAGAGTTCAGCCTTC CTCTAACCAAACCCACACTTTCTTTACCACCGTGATTCTCAGAGCCAGCAAGAAAGAAATGTTCCAAA AGGAAACCTCCATCTCAGCCATTTGCCCGGAGCCGAAGGTTGTGGGCTCCAGGCCTCTCAGTGAGGT TTGTTGCTTGTGTGTTTCCCGAGGAGCGGGCAGTCAGGCAGTGGTGGTTCTCTCTCCCCTCTCTCTG TCGCACGTGGGGTCTCAGCTACATTTACAAGACTTCACCACCATGTTGGAGAGCTGCTCCACTTTGG GGGTCCTCCCAACATAGTACAGGATGGTCAGGGGCTCCAGGTCCTGGGGCACGCAGCAAGGCGAG GCAGATGCTTCAGGGTTCAGAGTGTTGTACAGTCCCAGCACCGTGCTGTGGGTTGTGTCTGCACTGC GGAGGTATGGGCAAGGGCCTGAGCAGAAGTTGGCATAGTAGCCCTTAGGTTCATGGACCCACTTCC AGCCCAGATCCTGTCGGAAGTCAATGTAGAGGGGGCGCACACAGCAGTTCTCCTCCAAGTTGCGGA AGCAGTAATTGGTGTCCAAAGCCCGCTTCTTCCTCTGACCCCCCTGGCCCGGGTTGTCGAGCCGGTG TGGGGGAATCATCATGAGGATTAGATGAGGGTTGTGGTGATCCTTCTGCTTCTTGAGGCGCCCCAGA TCTCCACGGCCATGGTCATCCTCATTGTCCACGCCTTTGAATTTGATTTCCATCACCTCGTGAATGTTT TCCAGGATATCTCCATTGGGCTGAAAGGTGTGACATGGACAGTGAATGCTGATTTCTAGACCTAAGTT GGACTCTCTTCTCAACAGCCACTCACGCACAGTGTCAGTGACATCAAAGGACAGCCACTCGGCAGTG CCCCGTGTGGGCAGATTCTTGCCACCGATATAGCGCTGTTTGGCAATGTGCTCATCTGGCCGAAGGA TCTGGAAGAGCTCGATCCTCTGCTCATTCCGCTTAGAGCTGGGGTTGGGCACCCGCAAGACCCGGAA TTCTGCTCGGAATAGGTTGGTTCTATTTTTCTCCACTGAGGACACATTGAAGCGGAAAACCTTGGAGG 49 WO 2011/012713 PCT/EP2O1O/061 152 TAATTFCCTTTFAG GGCAGACAGCCAGTTFCGTTFGTG CTCCG CCAG CCCCTGGATCATGTCGAATTTFATG G ATTTFCTTTFGGCATAGTATTFCCGACTCGGTGTTTTFCCTG GGTGCAGCCTTFCCTCCCTCTCCCCATGCATC TCCTCCAGCAGCTCCCGGGTGCTGTTFGTAAAGGGCCAGGACCTGATAGGGGACGTGGGTCATCACC GTTFGG CTCAGG GGG GCTGGTGAGCCTGAGCTTFGCTCAAGATCTGTCCCCTAATGGCTTFCCACCCTCT TCTTFCTTGATGTG GCCGAAGTCCAAGGTGGTGCAAGTGGACAGAGAGAGGCTGACCGTGGCAAAGT TCAGCAGGGCCAG GACCACCAGAGCCCTTTFGCAAGTGCATCTTFCATGTGTGAGCTGGGAAGAGAGG CCAGGGGGACGGCAAGGCCTGGAGAGGAAGAGACCCCAGCAGACGTGCAGAAGGAGGGAGGAAA ACCAGGCG GCCTCCCCAGATCCCAAAGACTGAGG CTTGGCAAGAAGGTGCATGAACTCACTGCACT GCGAGAGCTTFCAGGACTTFCCAGGAAGCGCTGGCAACCCTGAGGACGAAGAAGCGGACTGTGTGCCT TGTAGCGCTGG GATTFCTTGTCCATGTGTCTAAACAGGTTTTFGCTG G Antisense of m-RNA of human Interleukin 10 (IL-tO) TCACCCTATGGAAACAGCTTFAAAAACAGGTGAAAATAATAAATATTFGAAAAAAATTFATAATATTFGGGCT TCTTTFCTAAATCGTTFCACAGAGAAGCTCAGTAAATAAATAGAAATGG GGGTTFGAGGTATCAGAGGTAA TAAATATTFCTATAAGAGAGGTACAATAAGGTTTFCTCAAGGG GCTGGGTCAGCTATCCCAGAG CCCCA GATCCGATTTTFGGAGACCTCTAATTTFATGTCCTAGAGTCTATAGAGTCGCCACCCTGATGTCTCAGTTF TCGTATCTTFCATTFGTCATGTAGGCTTFCTATGTAGTTFGATGAAGATGTCAAACTCACTCATGGCTTTFGTA GATG CCTTTFCTCTFG GAG CTTATTAAAG GCATTFCTTCACCTG CTCCACG G CCTTG CTCTTFGTTTTFCACA GGGAAGAAATCGATGACAGCGCCGTAGCCTCAGCCTGAGGGTCTTFCAGGTTFCTCCCCCAGGGAGTTF CACATGCGCCTTFGATGTCTGGGTCTTFGGTTFCTCAGCTTFGGG GCATCACCTCCTCCAGGTAAAACTGG ATCATCTCAGACAAGG CTTFGGCAACCCAGGTAACCCTTFAAAGTCCTCCAGCAAGGACTCCTTTFAACAA CAAGTTFGTCCAGCTGATCCTTFCATTTFGAAAGAAAGTCTTFCACTCTGCTGAAGGCATCTCGGAGATCTC GAAGCATGTTFAGGCAGGTTFGCCTGGGAAGTG GGTGCAGCTGTTFCTCAGACTGGGTGCCCTG GCCTG GGCTGGCCCTCACCCCAGTCAGGAGGACCAG GCAACAGAG CAGTGCTGAGCTGTGCATGCCTTFCTT TTFGCAAGTCTGTCTTFGTG GTTTFGGTTTTFGCAAGAG CAACCCCCTGATGTGTAGACCTTFCACCTCTCTG TCCCCCTTTTFATATTFGTAAGCTCAGGGAGGCCTCTTFCATFCATAAAAAGCCACAATCAAG GTTTFCCC GGCACAG GATTTTTTFCTGCTTFAGAGCTCCTCCTTFCTCTAACCTCTCTAATAAACTTFAGTTTTFCAATTTTTF GCATCGTAAGCAAAAATGATTFGGTTFGAACATGAACTTFCTGCATTFACAGCTATTTTTFAG GATGG GCTAC CTCTCTTFAGAATAATTTTTTFAGCTTFCTCAATTFAAAAAAAGTTFGATTTFCCTG GG GAGAACAGCTGTTFCTG TCCGCAGAGGCCCTCAG CTGTG GGTTFCTCATTFCG CGTGTTFCCTAGGTCACAGTGACGTGGACAAATTF 50 WO 2011/012713 PCT/EP2010/061152 GCCCATTCCAGAATACAATGGGATTGAGAAATAATTGG Antisense m-RNA of human Prostaglandin E2 Synthase tttttttttttttttttttttttttttttttttttttttttttttttttttttttttCCATGAGATGCCTGCCATGACAGGCGCCACAAAC CTTTCCTTTATTGCAAACATGTCCCAGTCCCGGGAGGCTTGGGAAGAGTGGGAACCAGGGGAACCCA GGGATGGGATTCCACTGAAAACAAACCGTCCTGCTGTCCTGTCGAGGGCCCCCACCCACAGGATGTA GCCATGGGACAGCCACTGAGGGTCCAGGAAGAGGGGCGGCAGAGCAGGGAGGCAGGGACAGGGA GGGGTCGCCCCAGGGCAGTGGCAGGGCTGGAACTCGTCCCTAACATCCCTGAGCCCCAGCAGGTGC CCTGTGTTAGAAGCGAGAGGGCTGGTGGGGGTGCGTGGACAAGGGGCAGAATGATCCTGCCCCCA ACCAGTATCGCCAGGCGCTGGCCCAGTGGCCCCAGGCCCTGGCAGCTGGCGTCTTCCGCTGCCTTC CCTCTGCTCTGCGCGGGGACATTCAGTGCGCTGGGGAGGCCTCGGTGATGGCCCTCTCCACCCGCA GGTACCAGGGCTGGATGTGCGTGTGCTGCATCAGGTCATCGAATGCATCCAGCCCCTCCATCACACG CAGCACGCCATACACCGCCAAATCAGCGAGATTCGGCTTCTGGCCCCCCATGAAGGGCCGGTCCTTG CCCACAGCAGCCACCCACTTGTCAGCAGCCTCATAGAGGTCCTCGCGCACGTTGTCCTGGAGGCGGT GCCTGCTCTTGAGTCGCTTGCTGATGAGGTACATGGCCGCTGCACCCATGTACTTGGCCACGGCACC CTCCACGGCTCCGAACTTGCCCTCGCGGACAATGTAGTCAAAGGACGCCAGAGCCTCGGTGGGCGT GCGGTACACATTGGGGGAGATCAGGTGCACCAGCCAGTCGTCCGCCCACTGCCGCCACTTCATCTCC TCCGTCCTGGCCTCCTTCCCACCATACACTTGCTGGGCCTCCTTCTCGTTGAGCATGAGCCAGTACTT ATTGCCGAACTCGGTCACCTCCTTGCCCTGCTCGTTCACAGCCTTCATGGCTGGGTAGTAGGTGATG ATCTCTTCCAGGGGCTGCCCCGACACCAGGTAGGTCTTGAGGGCGCTGATGATGACAGAGGAGTCA TTTAGTTGTTGCGAG CTTTCTCCTTCCTGGGCCACCAGGATGGG CACCTTTCTGTAGGAGGAGAACTT GATCTCAGCCCTGCGCACAGGGTTCACCTCCACCACCTGGTAGGGCAGGGCATGGAAGTCGAGGAA GGCTCGGACCTTGCTGCAGAAGGGACACGTCTTGTACTGGTACAGGGTCAGCTGCAGGCGGCTGGA CAGGGAGAGCTGCGCGGCTGAGCGCTCTGCGTGGAGGTCCTGGGCGCGCAGGTGCCACCGCGCCG TGTGGTACAGCCCCAGGGCTCCCCCCAGGGCCAGCGCCGCAGCTCCCAGCAGCCGCGGGCTCCCCT TACGAGCTGCAGCCACGGGGCTCGGGCCGCCCGCCGCCCCCGCGAAGCCAGCCCGGCTCTGCGTG GGTAGCAGCGGCTGGGGGCGGCCTCCCAGCCTCCAGGCCAAGGCGCACCCACCAGGCCACAGCGC CCGCACCACCCGCGCAGCCGGGTCCATGTTCGCTCCGCCGGCGCCGCGGGCGGGCGCGCGAAACG AAGACGCCGAGGCACGCGCGGCGTTTAAAGGGCCAGGACTCTGGCGCCCCGCGGGTTGGCCGGGG TGAGGGCGACGCTAAGGGAACCCTCAGCGCTCTCGGGACTGGGCGTGTGCCCGGCGCCCAAGTTC GAAACGCCCGCC 51 WO 2011/012713 PCT/EP2010/061152 Antisense m-RNA of human VEGF CAGTGTGCTGGCGGCCGCGGTGTGTCTACAGGAATCCCAGAAATAAAACTCTCTAATCTTCCGGGCT CGGTGATTTAGCAGCAAGAAAAATAAAATGGCGAATCCAATTCCAAGAGGGACCGTGCTGGGTCACC CGCCCGGGAATGCTTCCGCCGGAGTCTCGCCCTCCGGACCCAAAGTGCTCTGCGCAGAGTCTCCTCT TCCTTCATTTCAGGTTTCTGGATTAAGGACTGTTCTGTCGATGGTGATGGTGTGGTGGCGGCAGCGT GGTTTCTGTATCGATCGTTCTGTATCAGTCTTTCCTGGTGAGAGATCTGGTTCCCGAAACCCTGAGGG AGGCTCCTTCCTCCTGCCCGGCTCACCGCCTCGGCTTGTCACATCTGCAAGTACGTTCGTTTAACTCA AGCTGCCTCGCCTTGCAACGCGAGTCTGTGTTTTTGCAGGAACATTTACACGTCTGCGGATCTTGTAC AAACAAATGCTTTCTCCGCTCTGAGCAAGGCCCACAGGGATTTTCTTGTCTTGCTCTATCTTTCTTTGG TCTGCATTCACATTTGTTGTGCTGTAGGAAGCTCATCTCTCCTATGTGCTGGCCTTGGTGAGGTTTGA TCCGCATAATCTGCATGGTGATGTTGGACTCCTCAGTGGGCACACACTCCAGGCCCTCGTCATTGCA GCAGCCCCCGCATCGCATCAGGGGCACACAGGATGGCTTGAAGATGTACTCGATCTCATCAGGGTAC TCCTGGAAGATGTCCACCAGGGTCTCGATTGGATGGCAGTAGCTGCGCTGATAGACATCCATGAACT TCACCACTTCGTGATGATTCTGCCCTCCTCCTTCTGCCATGGGTGCAGCCTGGGACCACTTGGCATG GTGGAGGTAGAGCAGCAAGGCGAGGCTCCAATGCACCCAAGACAGCAGAAAGTTCATGGTTTCGGA GGCCCGACCGGGGCCGGGCCGGCTCGCGCCGGGCCGCCAGCACACTG Example 8 TGF-beta inhibitors Small molecules inhibiting TGF-beta SB-431542 TBRI kinase inhibitor from GlaxoSmithKline (Callahan et al. 2002, Laping et al. 2002, Inman et al. 2002) NPC30345 TBRI kinase inhibitor from Scios, Inc. (Dumont & Arteaga 2003) SD-093 TBR-I kinase inhibitor (Subramanian, G. et al. 2003) LY364947 TBRI kinase inhibitor from Lilly Inc. (Sawyer et al. 2003). Decorin a small chondroitin-dermatan sulfate proteoglycan that binds various forms of active TGF-B (Border et al. 1992). Proteins inhibiting TGF-beta 52 WO 2011/012713 PCT/EP2010/061152 Endoglin a TGF-B binding 95 kDa glycoprotein (Gougos et al. 1992). Antibodies binding TGF-beta CAT-192 humanized TGF-betal mAB from Genzyme/CAT (Benigni et al. 2003). CAT-152 humanized TGF-beta2 mAB from Genzyme/CAT (Siriwardena et al. 2002). 1D11 TGF-betal, 2, 3 mAB from Genzyme/CAT (Ananth et al. 1999). 2G7 TGF-betal, 2, 3 monoclonal IgG2 from Genentech., (Arteaga et al. 1993). Antibodies against TGF-beta 1, -2, or -3 from R&D see e.g. catalog 614 R&D systems, McKinley Place NE, Minneapolis , MN USA 55413 rabbit anti-TGF-beta2 LAP: (Schlotzer-Schrehardt, U. et al. 2001). Soluble Receptors sTBRII:Fc (RII/Fc hu IgG1 fusion protein) from Biogen (Muraoka et al. 2002, Rowland Goldsmith et al. 2001) sTBRII:Fc (Yang, Y.A. et al. 2002) Betaglycan (recombinant soluble TBRIII) (Bandyopadhyay et al. 2002) Example 9 Amino acid sequences of TGF-beta 1, -2 and -3 RXXR: cleavage site of the mature (active) part (XX may be anything) ASPC: the C of this motif is the C for the intermolecular cystine bridge that links the two monomers into a functional dimer C C C: intramolecular cystein bridges (cystein knot motif) mature protein of TGF-beta 1, 2 and 3 contains 112 amino acids from the end of this listing TGF-beta 1 MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL PEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAV PEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEI 53 WO 2011/012713 PCT/EP2010/061152 EGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQH LQSSRH RRALDTN YCFSSTEKNCCVRQLYIDFRKD LGWKWIH EPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASA APCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS preferred amino acid sequences of TGF-betal: 1) ALDTNYCFSSTEKNCCVRQL 2) YIDFRKDLGWKWIHEPKGYH 3) ANFCLGPCPYIWSLDTQYSK 4) VLALYNQHNPGASAAPCCVP 5) QALEPLPIVYYVGRKPKVEQ 6) LSNMIVRSCKCS 7) TEKNCCVRQLYIDFRKDLGW 8) KWIHEPKGYHANFCLGPCPY 9) WSLDTQYSKVLALYNQHNP 10) GASAAPCCVPQALEPLPIVY 11) YVGRKPKVEQLSNMIVRSCKCS 12) QYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKP 13) QYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKP I QYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKP (dimer of the TGF-betal amino acid sequence No.12 coupled by an s-s bridge at the Cytosins of the AAPC motif) 14)ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHAN FCLGPCPYIWSLDTQYSKVLALYNQ HNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 15) ALDTNYCFSSTEKNCCVRQLYIDFRKDLGW 16) KWIHEPKGYHANFCLGPCPYIWSLDTQYSK 17) VLALYNQHNPGASAAPCCVPQALEPLPIVY 18) YVGRKPKVEQLSNMIVRSCKCS 19) CVRQLYIDFRKDLGWKWIHEPKGYHANFCL 20) GPCPYIWSLDTQYSKVLALYNQHNPGASAA 21) PCCVPQALEPLPIVYYVGRKPKVEQLSNMI 54 WO 2011/012713 PCT/EP2010/061152 TGF-beta 2 MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISIYNS TRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNL VKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHK DRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLML LPSYRLESQQTNRRKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWS SDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS Preferred amino acid sequences of TGF-beta2 1) ALDAAYCFRNVQDNCCLRPL 2) YIDFKRDLGWKWIHEPKGYN 3) ANFCAGACPYLWSSDTQHSR 4) VLSLYNTINPEASASPCCVS 5) QDLEPLTILYYIGKTPKIEQ 6) LSNMIVKSCKCS 7) VQDNCCLRPLYIDFKRDLGW 8) KWIHEPKGYNANFCAGACPY 9) LWSSDTQHSRVLSLYNTINP 10) EASASPCCVSQDLEPLTILY 11) YIGKTPKIEQLSNMIVKSCKCS 12) QHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPK 13) QHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPK I QHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPK (dimer of the TGF-beta2 amino acid sequence No.12 coupled by an s-s bridge at the Cytosins of the ASPC motif) 14)ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNAN FCAGACPYLWSSDTQHSRVLSLYN TIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSN MIVKSCKCS 15) ALDAAYCFRNVQDNCCLRPLYIDFKRDLGW 16) KWIHEPKGYNANFCAGACPYLWSSDTQHSR 55 WO 2011/012713 PCT/EP2010/061152 17) VLSLYNTINPEASASPCCVSQDLEPLTILY 18) YIGKTPKIEQLSNMIVKSCKCS 19) CLRPLYIDFKRDLGWKWIHEPKGYNANFCA 20) GACPYLWSSDTQHSRVLSLYNTINPEASAS 21) PCCVSQDLEPLTILYYIGKTPKIEQLSNMI TGF-beta3 MKMH LQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVLA LYNSTRELLEEMH GEREEGCTQENTESEYYAKEIH KFDMIQGLAEH NELAVCPKGITSKVFRFNVSSVEK NRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREW LLRRESNLGLEISIHCPCHTFQPNGDILENIH EVM EIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILM MIPPHRLDNPGQGGQRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNANFCAGACP YLWSSDTQHSRVLSLYNTINPEASASPCCVSQD LEPLTILYYIGKTPKIEQLSNMIVKSCKCS preferred amino acid sequences of TGF-beta3: 1) ALDTNYCFRNLEENCCVRPL 2) YIDFRQDLGWKWVHEPKGYY 3) ANFCSGPCPYLRSADTTHST 4) VLGLYNTLNPEASASPCCVP 5) QDLEPLTILYYVGRTPKVEQ 6) LSNMVVKSCKCS 7 NLEENCCVRPLYIDFRQDLG 8 WKWVHEPKGYYANFCSGPCP 9) YLRSADTTHSTVLGLYNTLN 10) PEASASPCCVPQDLEPLTIL 11) YYVGRTPKVEQLSNMVVKSCKCS 12) THSTVLGLYNTLN PEASASPCCVPQDLEPLTILYYVGRTPK 13) THSTVLGLYNTLN PEASASPCCVPQDLEPLTILYYVGRTPK I THSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPK (dimer of the TGF-beta3 amino acid sequence No.12 coupled by an s-s bridge at the 56 WO 2011/012713 PCT/EP2010/061152 cytosins of the ASPC motif) 14)ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNAN FCAGACPYLWSSDTQHSRVLSLYN TIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSN MIVKSCKCS 15) ALDAAYCFRNVQDNCCLRPLYIDFKRDLGW 16) KWIHEPKGYNANFCAGACPYLWSSDTQHSR 17) VLSLYNTINPEASASPCCVSQDLEPLTILY 18) YIGKTPKIEQLSNMIVKSCKCS 19) CLRPLYIDFKRDLGWKWIHEPKGYNANFCA 20) GACPYLWSSDTQHSRVLSLYNTINPEASAS 21) PCCVSQDLEPLTILYYIGKTPKIEQLSNMI 57 WO 2011/012713 PCT/EP2010/061152 seguenzen Seq. Id.Sequences Length No. int. Bez. int. No. TGF-beta 1 1 CGATAGTC 14 TTGCAG 2 GTCGATAG 14 2 TCTTGC 3 CTTGGACA 14 3 GGATCT 4 CCAGGAAT 14 4 TGTTGC 5 CCTCAATTT 14 5 CCCCT 6 GATGTCCA 14 6 CTTGCA 7 CTCCAAAT 14 7 GTAGGG 8 ACCTTGCT 14 8 GTACTG 9 GTAGTACA 14 9 CGATGG 10 CACGTAGT 14 10 ACACGA 11 CATGTTGG 14 11 ACAGCT 12 GCACGATC 14 12 ATGTTG 13 TGTACTCT 16 13 GCTTGAAC 58 WO 2011/012713 PCT/EP2010/061152 14 CTGATGTG 18 14 TTGAAGAA CA 15 CTCTGATG 16 15 TGTTGAAG 16 GGAAGTCA 16 16 ATGTACAG 17 CATGTCGA 18 17 TAGTCTTG :CA 18 AGCTGAAG 18 18 CAATAGTT GG 19 GTCATAGA 18 19 TTTCGTTGT G 20 CTCCACTTT 18 20 TAACTTGA G 21 TGCTGTATT 18 21 TCTGGTAC A TGF-beta 2 22 CACACAGT 14 1 AGTGCA 23 GCACACAG 14 2 TAGTGC 24 GCTTGCTC 17 3 AGGATCTG C 25 TACTCTTCG 14 4 TCGCT 59 WO 2011/012713 PCT/EP2010/061152 26 CTTGGCGT 14 5 AGTACT 27 GTAAACCT 14 6 CCTTGG 28 GTCTATTTT 19 7 GTAAACCT cc 29 GCATGTCT 20 8 ATTTTGTAA ACC 30 CGGCATGT 18 9 CTATTTTGT A 31 GGCATCAA 14 10 GGTACC 32 CTGTAGAA 14 11 AGTGGG 33 ACAATTCT 18 12 GAAGTAGG GT 34 TCACCAAAT 18 13 TGGAAGCA 35 GCTTTCAC 20 14 CAAATTGG AAGC 36 CTGGCTTTT 14 15 GGGTT 37 TCTGATATA 18 16 GCTCAATC C 60 WO 2011/012713 PCT/EP2010/061152 38 TCCTAGTG 18 17 GACTTTATA G 39 1 1 1 1 1CCTA 16 18 GTGGACT 40 CAATTATCC 19 19 TGCACATTT 41 GCAATTAT 16 20 CCTGCACA 42 GCAGCAAT 16 21 TATCCTGC 43 TGGCATTG 14 22 TACCCT 44 TGTGCTGA 14 23 GTGTCT 45 CCTGCTGT 16 24 GCTGAGTG 46 CTTGGGTG 14 25 TTTTGC 47 TTTAGCTG 18 26 CATTTGCA AG 48 GCCACTTTF14 27 CCAAG TGF-beta 3 49 TCGAGCTT 14 107 TGF-B3-98 CCCCCA 50 CCCCGAGC 14 108 TGF-B3-98 CCAAGG 2 :51 :CCCGACGA 13 109 GF-3-98 61 WO 2011/012713 PCT/EP2010/061152 GCCGG 3 52 ACGCACCA .14 .110 TGF-B3-98 AGGCGA 4 53 CGGGTTGT 15 111 TGF-B3-98 CGAGCCC 5 54 CGGCAGTG 13 112 TGF-B3-98 CCCCG 6 55 CGCAATTC 14 113 TGF-B3-98 TGCTCG :.7 56 TTCGTTGT 14 114 TGF-B3-98 GCTCCC 8 57 ATTCCGAC .14 :115 TGF-B3-98 TCGGTG 9 58 ACGTGCGT 17 116 TGF-B3-98 CATCACCG 10 59 CCAAGAAG 10 117 TGF-B3-98 CC 11 60 CCTAATGC .14 .118 TGF-B3-312 CTTCCA 61 TCAGCAGG 14 187 GF-B-3rwk GCCAGG 1 62 GCAAAGTT 17 188 GF-B-3rwk CAGCAGGG 2 63 GGCAAAGT 16 189 GF-B-3rwk TCAGCAGG 3 64 GTGGCAAA 18 190 GF-B-3rwk GTTCAGCA 4 GG 62 WO 2011/012713 PCT/EP2010/061152 65 GTGGCAAA 14 191 GF-B-3rwk GTTCAG 5 66 GACCGTGG .18 :192 .GF-B-3rwk CAAAGTTC 6 AG 67 AGAGAGGC 15 193 GF-B-3rwk TGACCGT 7 68 GAGAGAGA 17 194 GF-B-3rwk GAGGCTGA 8 C 69 ACAGAGAG 15 .195 .GF-B-3rwk GGCTGA .. 9 70 GTGGACAG 15 196 GF-B-3rwk AGAGAGG 10 71 CAACTGGA 18 197 GF-B-3rwk CAGAGAGA 11 GG 72 TCTTCTTGA:16 198 .GF-B-3rwk TGTGGCC .12 73 CCCTCTTCT 17 199 GF-B-3rwk TCTTGATG 13 74 CACCCTCTT 14 200 GF-B-3rwk CTTCT 14 75 ATGGATTT 17 201 GF-B-3rwk CTTTGGCA 15 T 76 GGATTTCTT 13 202 GF-B-3rwk TGGC 16 77 AAGTTGGA 18 203. .GF-B-3rwk CTCTCTTCT 17 63 WO 2011/012713 PCT/EP2010/061152 C 78 TAAGTTGG .18 :204. .GF-B-3rwk ACTCTCTTC. ::18 PGE 79 TAGGAGTG 16 1539 Prostaglan. GTTGAGGC Rec.EP3-1 80 GTGTAGGA 17 1540 Prostaglan. GTGGTTGA Rec.EP3-2 G 81 CTGTGTAG 14 1541 Prostaglan. GAGTGG . Rec.EP3-3 82 CCCACATG 14 1542 Prostaglan. CCTGTG Rec. EP3 83 CGATGAAC 14 1543 Prostaglan. AACGAG Rec. EP3-5 84 CTGGCGAT 16 1544 Prostaglan. GAACAACG Rec.EP3-6 85 CGCTGGCG 14 1545 Prostaglan. ATGAAC Rec.EP3-7 86 GAGCTAGT 15 1546 Prostaglan. CCCGTTG . Rec.EP3-8 87 GCGAAGAG 15 1547 Prostaglan. CTAGTCC Rec.EP3-9 88 CCAGTTAT 17 1548 Prostaglan. GCGAAGAG Rec.EP3-10 C 89 CCCCAGTT 16 1549 Prostaglan. ATGCGAAG . Rec.EP3-11 VEGF 90 CGGCCGCG 14 119 VEGF-98-1 GTGTGT 64 WO 2011/012713 PCT/EP2010/061152 91 CGGGAATG 17 120 VEGF-98-2 CTTCCGCC G 92 CGGCTCAC 17 121 VEGF-98-3 CGCCTCGG C 93 CACGTCTG 14 122 VEGF-98-4 CGGATC 94 CCCCGCAT 18 123 VEGF-98-5 CGCATCAG :GG 95 CGCCTTGC .14 :124 VEGF-98-6 AACGCG 96 CCGACCGG 14 125 VEGF-98-7 GGCCGG 97 GTTCATGG 14 126 VEGF-49 TTTCGG 98 GCAGAAAG 15 127 VEGF-55 TTCATGG 99 GCTGATAG 14 128 VEGF-188 ACATCC 100 GCGCTGAT 14 129 VEGF-190 AGACAT 101 GTAGCTGC 16 130 VEGF-194 GCTGATAG 102 CTCGATCT 14 131 VEGF-253 CATCAG 103 ATGTACTC 17 132 VEGF-255 GATCTCAT 65 WO 2011/012713 PCT/EP2010/061152 104 GAAGATGT 16 133 VEGF-260 ACTCGATC 105 CTTGAAGA 16 :134 VEGF-263 TGTACTCG 106 GCATCGCA 14 135 VEGF-292 TCAGGG 107 CCGCATCG 14 136 VEGF-294 CATCAG 108 CATTTGTTG:18 137 VEGF-422 TGCTGTAG :G 109 GGTCTGCA 18 138 VEGF-434 TTCACATTT G 110 CTTTGGTCT 15 139 VEGF-441 GCATTC 111 CTTTCTTTG 15 140 VEGF-445 GTCTGC 112 GCTCTATCT:17 141 VEGF-450 TTCTTTGG 113 GTCTTGCT 17 :142 VEGF-455 CTATCTTTC 114 CTTGTCTTG 16 143 VEGF-459 CTCTATC 115 CATCTGCA 18 144 VEGF-596 AGTACGTT CG 116 CACATCTG 18 145 VEGF-598 CAAGTACG 176 66 WO 2011/012713 PCT/EP2010/061152 117 GTCACATC 18 146 VEGF-600 TGCAAGTA CG 118 CATCTGCA 14 147 VEGF-600 AGTACG 2 119 CACATCTG 15 148 VEGF-601 CAAGTAC 120 GTCACATC 14 149 VEGF-604 TGCAAG 121 CTTGTCAC :14 150 VEGF-607 ATCTGC 122 GGCTTGTC 16 151 VEGF-607 ACATCTGC 2 123 CTCGGCTT 16 152 VEGF-610 GTCACATC 124 CTCCTTCCT 14 153 VEGF-638 CCTGC 125 GCTTGAAG 16 154 VEGF-766 ATGTACCT :CG 126 CGTTGCTC .15 :155 VEGF-r TCCGACG 1062 IL-10 127 GTAAAACT 16 156 U16720 GGATCATC TC CTTCTTTTG CAAGTCTG 128 T 18 TGAGCTGT 129 GCATGCCT 18 67 WO 2011/012713 PCT/EP2010/061152 TC AGTCAGGA 130 GGACCAG 15 TGGGTGCC 131 CTGGCCT 15 CATGTTAG 132 GCAGGTT 15 AGGCATCT CGGAGATC 133 T 17 AAAGTCTT 134 CACTCTGC 16 AACAAGTT GTCCAGCT 135 G 17 CATCACCT 136 CCTCCAG 15 GGGTCTTC AGGTTCTC 137 CC 18 CACGGCCT TGCTCTTGT 138 T 18 TTATTAAAG 139 GCATTCTTC:18 AAGATGTC AAACTCACT 140 C 18 GTAGTTGA :141 TGAAGATG 18 68 WO 2011/012713 PCT/EP2010/061152 TC GATTTTGG 142 AGACCTCT 16 TCAGCTAT 143 CCCAGAGC 16 GGCTGGGT 144 CAGCTAT 15 AAATCGTT CACAGAGA 145 AG 18 TCTTTCTAA ATCGTTCA 146 C 18 69
权利要求:
Claims (12) [1] 1. Pharmaceutical composition comprising a chemotherapeutic and a TGF-beta antisense oligonucleotide, wherein the antisense oligonucleotide reduces the IC 50 of the cytotoxicity of the chemotherapeutic. [2] 2. The pharmaceutical composition according to claim 1, wherein the TGF-beta antisense oligonucleotide reduces the IC 50 of the chemotherapeutic 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%. [3] 3. The pharmaceutical composition according to claim 1 or 2, wherein the chemotherapeutic is selected from the group consisting of gemcitabine, 5 fluorouracil, temozolomide, dacarbacine, docetaxel, cisplatin, oxaliplatin, tamoxifen, and irinotecan. [4] 4. The pharmaceutical composition according to any of claims 1 to 3, wherein the antisense oligonucleotide is a TGF-beta 2 antisense oligonucleotide, TGF-beta 1 antisense oligonucleotide, or aTGF-beta 3 antisense oligonucleotide. [5] 5. The pharmaceutical composition according to claim 4, wherein the TGF-beta 2 antisense oligonucleotide is selected from the group consisting of SEQ ID NO. 22 to 48, the TGF-beta 1 antisense oligonucleotide is selected from the group consisting of SEQ ID NO. 1 to 21, and the TGF-beta 3 antisense oligonucleotide is selected from the group consisting of SEQ ID NO. 49 to 78. [6] 6. The pharmaceutical composition according to any of claims 1 to 5, further comprising a pharmaceutically acceptable carrier, filler, lubricant, diluent, excipient, 70 WO 2011/012713 PCT/EP2010/061152 disintegrate, and/or adjuvant. [7] 7. The pharmaceutical composition according to any of claims 1 to 6 for use in treating a neoplastic disease. [8] 8. The pharmaceutical composition according to claim 7, wherein the neoplastic disease is selected from the group consisting of pancreatic cancer, melanoma, brain tumor, bladder cancer, renal carcinoma, lung cancer, breast cancer, ovary cancer, prostate cancer, colorectal cancer, gastric cancer, endometrial cancer, osteosarcoma, myosarcoma, blood born tumors, leukemias, tumor metastasis, hemangiomas, acoustic neuromas, neurofibromas, trachomas, pyogenic, granulomas, psoriasis, astracytoma, acoustic neuroma, blastoma, Ewing 's tumor, craniopharyngloma, ependymoma, medulloblastoma, glioma, hemangloblastoma, Hodgkins-lymphoma, medullablastoma, leukaemia, mesothelioma, neuroblastoma, neurofibroma, non-Hodgkins lymphoma, pinealoma, retinoblastoma, sarcoma, seminoma, trachomas, Wilm's tumor, bile duct carcinoma, bladder carcinoma, brain tumor, breast cancer, bronchogenic carcinoma, carcinoma of the kidney, cervical cancer, choriocarcinoma, cystadenocarcinome, embrional carcinoma, epithelial carcinoma, esophageal cancer, cervical carcinoma, colon carcinoma, colorectal carcinoma, endometrial cancer, gallbladder cancer, gastric cancer, head cancer, liver carcinoma, lung carcinoma, medullary carcinoma, neck cancer, non-small-cell bronchogenic/lung carcinoma, ovarian cancer, pancreas carcinoma, papillary carcinoma, papillary adenocarcinoma, prostata cancer, small intestine carcinoma, prostate carcinoma, rectal cancer, renal cell carcinoma, skin cancer, small-cell bronchogenic/lung carcinoma, squamous cell carcinoma, sebaceous gland carcinoma, testicular carcinoma, and uterine cancer. 71 WO 2011/012713 PCT/EP2010/061152 [9] 9. The pharmaceutical composition according to claim 8, wherein the brain tumor is a glioma, an astrocytoma, an oligodendroglioma, an anaplastic oligoastrozytoma, a glioblastoma, a brain metastasis, a myeloma, or a plasmocytoma. [10] 10. The pharmaceutical composition according to any of claims 7, 8, or 9, wherein the pharmaceutical composition is administered orally, intravenously, intracranially, intraperitoneally, intravesically, parenterally, topically, transdermally, subconjunctivally, or sublingually. [11] 11. The pharmaceutical composition according to any of claims 7, 8, 9, or 10, wherein the chemotherapeutic and the antisense oligonucleotide are administered at the same time, partially timely overlapping, or timely distinct. [12] 12. Method for the preparation of a pharmaceutical composition according to any of claims 1 to 7. 72
类似技术:
公开号 | 公开日 | 专利标题 AU2010277554B2|2015-02-19|Combination of a chemotherapeutic agent and an inhibitor of the TGF-beta system AU2004299670B2|2010-04-22|Combination therapy associating a TGF-beta antagonist with a chemotherapeutic agent US20030055014A1|2003-03-20|Inhibition of angiogenesis by nucleic acids AU720704B2|2000-06-08|Conjugates of cis-docosahexaenoic acid and paclitaxel US20080125380A1|2008-05-29|Fatty acid-anticancer conjugates and uses thereof JP2012092110A|2012-05-17|Use of asiatic acid or asiaticoside for cancer treatment WO2005099773A1|2005-10-27|Use of erythropoietin for treatment of cancer WO1997044336A9|1998-04-16|Conjugates of cis-docosahexaenoic acid and paclitaxel EP2248895A2|2010-11-10|Combination therapy associating a TGF-beta antagonist with a chemotherapeutic agent WO2000067802A1|2000-11-16|Fatty acid-n-substituted indol-3-glyoxyl-amide compositions and uses thereof US20090143418A1|2009-06-04|Compositions and Methods for Preventing and Treating Hair Growth Cycle-Related Conditions JP2022506958A|2022-01-17|MicroRNA compounds and methods for regulating MIR-10B activity US20180010195A1|2018-01-11|Compositions and methods for monitoring, diagnosis, prognosis, detection, and treatment of cancer EP3880211A1|2021-09-22|Modulators of foxp3 expression US20200181711A1|2020-06-11|Compositions and methods for monitoring, diagnosis, prognosis, detection, and treatment of cancer WO2020160453A1|2020-08-06|Modulators of yap1 expression
同族专利:
公开号 | 公开日 MX2012001244A|2012-03-26| WO2011012713A1|2011-02-03| US20120027873A1|2012-02-02| CA2769618A1|2011-02-03| ECSP12011689A|2012-06-29| KR20120107456A|2012-10-02| EP2340308A1|2011-07-06| AU2010277554B2|2015-02-19| IN2012DN00969A|2015-04-10| US8476246B2|2013-07-02| RU2012107535A|2013-09-10| JP2013500313A|2013-01-07| BR112012002102A2|2017-05-02| CO6511199A2|2012-08-31| EP2340308B1|2014-12-24| CN102712924A|2012-10-03| CL2012000247A1|2013-07-05| IL217821D0|2012-03-29| PE20121495A1|2012-11-19|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题 US3854480A|1969-04-01|1974-12-17|Alza Corp|Drug-delivery system| US4469863A|1980-11-12|1984-09-04|Ts O Paul O P|Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof| US4675189A|1980-11-18|1987-06-23|Syntex Inc.|Microencapsulation of water soluble active polypeptides| DE3280400D1|1981-10-23|1992-06-04|Molecular Biosystems Inc|OLIGONUCLEOTIDES MEDICINE AND THEIR PRODUCTION METHOD.| US5023243A|1981-10-23|1991-06-11|Molecular Biosystems, Inc.|Oligonucleotide therapeutic agent and method of making same| US4452775A|1982-12-03|1984-06-05|Syntex Inc.|Cholesterol matrix delivery system for sustained release of macromolecules| US5075109A|1986-10-24|1991-12-24|Southern Research Institute|Method of potentiating an immune response| US5133974A|1989-05-05|1992-07-28|Kv Pharmaceutical Company|Extended release pharmaceutical formulations| US5719262A|1993-11-22|1998-02-17|Buchardt, Deceased; Ole|Peptide nucleic acids having amino acid side chains| US5714331A|1991-05-24|1998-02-03|Buchardt, Deceased; Ole|Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility| US5407686A|1991-11-27|1995-04-18|Sidmak Laboratories, Inc.|Sustained release composition for oral administration of active ingredient| US5539082A|1993-04-26|1996-07-23|Nielsen; Peter E.|Peptide nucleic acids| US5736152A|1995-10-27|1998-04-07|Atrix Laboratories, Inc.|Non-polymeric sustained release delivery system| EP0856579A1|1997-01-31|1998-08-05|BIOGNOSTIK GESELLSCHAFT FÜR BIOMOLEKULARE DIAGNOSTIK mbH|An antisense oligonucleotide preparation method| US7795232B1|2000-08-25|2010-09-14|Genta Incorporated|Methods of treatment of a bcl-2 disorder using bcl-2 antisense oligomers| US6809118B2|2002-07-25|2004-10-26|Yih-Lin Chung|Methods for therapy of radiation cutaneous syndrome| US7807844B2|2003-09-04|2010-10-05|Nihon University|TGF-β gene expression inhibitor| CN1902488A|2003-11-13|2007-01-24|健泰科生物技术公司|Screening assays and methods of tumor treatment| WO2005050200A2|2003-11-13|2005-06-02|Genentech, Inc.|Screening assays and methods of tumor treatment| ES2594734T3|2003-12-19|2016-12-22|Autotelic Llc|Combination therapy that associates a TGF-beta antagonist with a chemotherapeutic agent| US20070155685A1|2004-02-27|2007-07-05|Karl-Hermann Schlingensiepen|Pharmaceutical composition| US20090186076A1|2006-02-01|2009-07-23|Kazunori Kataoka|Combined Use of TGF-Beta Signaling Inhibitor and Antitumor Agent| JP5322476B2|2008-03-31|2013-10-23|テルモ株式会社|Liposome production apparatus and liposome production method|NZ533126A|2002-01-17|2006-04-28|Univ British Columbia|Bispecific antisense oligonucleotides that inhibit IGFBP-2 and IGFBP-5 and methods of using same| EP2625292B1|2010-10-07|2018-12-05|The General Hospital Corporation|Biomarkers of cancer| TWI454281B|2011-10-06|2014-10-01|Nat Univ Tsing Hua|Use of boric acid in boron neutron capture therapy for liver cancer| WO2013124869A2|2012-02-21|2013-08-29|Amrita Vishwa Vidyapeetham University|The art, method,manner process and system of fibrous bio-degradable polymeric wafers for the local delivery of therapeutic agents in combinations| WO2014159774A1|2013-03-14|2014-10-02|Teva Pharmaceutical Industries Ltd.|Custirsen treatment with reduced toxicity| US10386359B2|2014-05-23|2019-08-20|Inserm |Methods for determining whether a patient will achieve a response after radiation therapy| US20180161429A1|2015-06-26|2018-06-14|Beth Israel Deaconess Medical Center Inc.|Cancer therapy targeting tetraspanin 33in myeloid derived suppressor cells| KR101843985B1|2016-02-09|2018-03-30|오토텔릭 엘엘씨|Compositions and methods for treating cancer| KR101843984B1|2016-02-09|2018-03-30|오토텔릭 엘엘씨|Compositions and methods for treating pancreatic cancer| US9758786B2|2016-02-09|2017-09-12|Autotelic, Llc|Compositions and methods for treating pancreatic cancer| EP3532638A4|2016-10-31|2020-07-29|University of Massachusetts|Targeting microrna-101-3p in cancer therapy| WO2018089688A1|2016-11-09|2018-05-17|Jinjun Shi|Restoration of tumor suppression using mrna-based delivery system| CN112933238A|2021-02-02|2021-06-11|石河子大学|Application of substance inhibiting TGF-beta R1 gene expression and cisplatin in treatment and/or prevention of esophageal cancer|
法律状态:
2015-06-18| FGA| Letters patent sealed or granted (standard patent)| 2016-02-25| MK14| Patent ceased section 143(a) (annual fees not paid) or expired|
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 EP09166893||2009-07-30|| EP09166893.9||2009-07-30|| PCT/EP2010/061152|WO2011012713A1|2009-07-30|2010-07-30|Combination of a chemotherapeutic agent and an inhibitor of the tgf-beta system| 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
|